Recombinant Human Islet-2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Islet-2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-359 of Human ISL2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ISL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
66.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Islet-2 GST (N-Term) Protein

  • FLJ10160
  • insulin gene enhancer protein ISL-2
  • ISL LIM homeobox 2
  • ISL2 transcription factor, LIM/homeodomain, (islet-2)
  • ISL2
  • Islet2
  • Islet-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01926
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-84135
Species: Hu
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NBP1-49672
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
NBP2-24691
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84476
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: All-NA
Applications: WB, IHC, IHC-P
H00089884-M15
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00079191-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-94321
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-24607
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB

Publications for Islet-2 Recombinant Protein (H00064843-P01) (0)

There are no publications for Islet-2 Recombinant Protein (H00064843-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Islet-2 Recombinant Protein (H00064843-P01) (0)

There are no reviews for Islet-2 Recombinant Protein (H00064843-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Islet-2 Recombinant Protein (H00064843-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Islet-2 Products

Bioinformatics Tool for Islet-2 Recombinant Protein (H00064843-P01)

Discover related pathways, diseases and genes to Islet-2 Recombinant Protein (H00064843-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Islet-2 Recombinant Protein (H00064843-P01)

Discover more about diseases related to Islet-2 Recombinant Protein (H00064843-P01).
 

Pathways for Islet-2 Recombinant Protein (H00064843-P01)

View related products by pathway.

Blogs on Islet-2

There are no specific blogs for Islet-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NKX6.1 Antibody
NBP1-49672

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Islet-2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ISL2