Islet-2 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-Islet-2 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Islet-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIH
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ISL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10 ugs per reaction
• Control Peptide:

  Islet-2 Recombinant Protein Antigen (NBP2-57938PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Islet-2 Antibody - BSA Free

• FLJ10160
• insulin gene enhancer protein ISL-2
• ISL LIM homeobox 2
• ISL2 transcription factor, LIM/homeodomain, (islet-2)
• ISL2
• Islet2
• Islet-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ISL2