Islet-2 Antibody

Images

 
Western Blot: Islet-2 Antibody [H00064843-B01P] - Analysis of ISL2 expression in transfected 293T cell line by ISL2 polyclonal antibody. Lane 1: ISL2 transfected lysate(39.49 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Islet-2 Antibody [H00064843-B01P] - Analysis of purified antibody to ISL2 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Islet-2 Antibody Summary

Immunogen
ISL2 (NP_665804.1, 1 a.a. - 359 a.a.) full-length human protein. MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Specificity
ISL2 - ISL LIM homeobox 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ISL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence.
Publications
Read Publication using H00064843-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Islet-2 Antibody

  • FLJ10160
  • insulin gene enhancer protein ISL-2
  • ISL LIM homeobox 2
  • ISL2 transcription factor, LIM/homeodomain, (islet-2)
  • ISL2
  • Islet2
  • Islet-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01926
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-84135
Species: Hu
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NBP1-49672
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
NBP2-24691
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84476
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm, All-NA
Applications: WB, IHC, IHC-P
H00089884-D01P
Species: Hu
Applications: WB, ICC/IF
H00079191-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-94321
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-24607
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB

Publications for Islet-2 Antibody (H00064843-B01P)(1)

Reviews for Islet-2 Antibody (H00064843-B01P) (0)

There are no reviews for Islet-2 Antibody (H00064843-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Islet-2 Antibody (H00064843-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Islet-2 Products

Bioinformatics Tool for Islet-2 Antibody (H00064843-B01P)

Discover related pathways, diseases and genes to Islet-2 Antibody (H00064843-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Islet-2 Antibody (H00064843-B01P)

Discover more about diseases related to Islet-2 Antibody (H00064843-B01P).
 

Pathways for Islet-2 Antibody (H00064843-B01P)

View related products by pathway.

Blogs on Islet-2

There are no specific blogs for Islet-2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Islet-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISL2
Entrez
Uniprot