IP3R1 Antibody (2B6)

Product Discontinued

IP3R1 Antibody (2B6) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ITPR1 (NP_002213, 2470 a.a. ~ 2577 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI
• Specificity: ITPR1 - inositol 1,4,5-triphosphate receptor, type 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ITPR1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Reactivity Notes

Porcine reactivity reported in scientific literature (PMID: 22946060).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IP3R1 Antibody (2B6)

• DKFZp313E1334
• DKFZp313N1434
• inositol 14,5-triphosphate receptor, type 1
• inositol 14,5-trisphosphate receptor type 1
• InsP3R1
• IP3 receptor isoform 1
• IP3 receptor
• IP3R 1
• IP3R
• IP3R1
• ITPR1
• SCA15
• SCA16
• spinocerebellar ataxia 15
• spinocerebellar ataxia 16
• Type 1 inositol 14,5-trisphosphate receptor
• Type 1 InsP3 receptor

Background

Inositol 1,4,5-trisphosphate (IP3) is a second messenger for many growth factors, hormones, and neurotransmitters. Upon binding to the IP3 receptor (IP3R), IP3 triggers the release of intracellular, luminal calcium to the cytosol. Functional IP3R is a homo- or heterotetramer of ~240 kDa glycoprotein subunits, that is structurally reminiscent of members of the voltage-gated ion channel superfamily. IP3R protein is structurally and functionally related to one other important intracellular calcium-release channel, the ryanodine receptor. The similarity between the two receptors continues at the physiological level owing to a physical association each receptor can have with the immunophilin protein, FKBP12. Cytosolic calcium levels appear to be regulated by a feedback loop that starts with calcium activation of protein kinase C (PKC) and calcineurin, a protein phosphatase. Phosphorylation of the IP3R by PKC causes an increase in IP3-mediated calcium release. Concomitantly, the phosphatase activity of calcineurin is stimulated upon its association with the FKBP12-IP3R complex. Calcium release is reduced when the PKC target site on the IP3R is dephosphorylated by calcineurin resulting in calcium oscillations. Mammalian IP3R subunits are the product of three distinct genes that are widely expressed and differentially regulated. IP3R type I (IP3R-I) has been detected in heart, liver, kidney, ovary, and Purkinje neurons of the cerebellum. IP3R-II is found predominantly in the brain. IP3R-III is known to be expressed in pancreatic islets, kidney, and the gastrointestinal tract. Inositol 1,4,5-trisphosphate (IP3) is a second messenger for many growth factors, hormones, and neuro-transmitters. Upon binding to the IP3 receptor (IP3R), IP3 triggers the release of intracellular, luminal calcium to the cytosol. Functional IP3R is a homo- or heterotetramer of ~240 kDa glycoprotein subunits, that is structurally reminiscent of members of the voltage-gated ion channel superfamily. IP3R protein is structurally and functionally related to one other important intracellular calcium-release channel, the ryanodine receptor. The similarity between the two receptors continues at the physiological level owing to a physical association each receptor can have with the immunophilin protein, FKBP12. Cytosolic calcium levels appear to be regulated by a feedback loop that starts with calcium activation of protein kinase C (PKC) and calcineurin, a protein phosphatase. Phosphorylation of the IP3R by PKC causes an increase in IP3-mediated calcium release. Concomitantly, the phosphatase activity of calcineurin is stimulated upon its association with the FKBP12-IP3R complex. Calcium release is reduced when the PKC target site on the IP3R is dephosphorylated by calcineurin resulting in calcium oscillations. Mammalian IP3R subunits are the product of three distinct genes that are widely expressed and differentially regulated. Type-I IP3R has been detected in heart, liver, kidney, ovary, and Purkinje neurons of the cerebellum. IP3R-II protein is found predominantly in the brain. Isoform III expression has been shown to occur in pancreatic islets, kidney and the gastrointestinal tract.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IP3R1 Antibody (H00003708-M01)(1)

Publication using H00003708-M01

• Olson ML, Sandison ME, Chalmers S, McCarron JG. Microdomains of muscarinic acetylcholine and Ins(1,4,5)P(3) receptors create 'Ins(1,4,5)P(3) junctions' and sites of Ca(2)+ wave initiation in smooth muscle. J Cell Sci. 2012-11-15 [PMID: 22946060] (Porcine)

Bioinformatics

• Gene Symbol: ITPR1
• Entrez:
  • 3708(Human)
• OMIM:
  • 147265(Human)
• Uniprot:
  • NP_002213(Human)