Recombinant Human Inversin Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Inversin Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-91 of Human Inversin

Source: Wheat Germ

Amino Acid Sequence: MNKSENLLFAGSSLASQVHAAAVNGDKGALQRLIVGNSALKDKEDQFGRTPLMYCVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
INVS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Inversin Protein

  • inversin
  • Inversion of embryo turning homolog
  • INVMGC133081
  • KIAA0573
  • MGC133080
  • nephrocystin 2
  • nephrocystin-2
  • nephronophthisis 2 (infantile)
  • NPH2
  • NPHP2inversion of embryonic turning

Background

INVS - inversin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45545
Species: Hu
Applications: WB, IHC
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87025
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67779
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP2-45603
Species: Hu
Applications: WB, Flow, IHC
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB7357
Species: Hu
Applications: WB
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-48848
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7349
Species: Hu, Mu
Applications: WB, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5129
Species: Hu
Applications: WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA

Publications for Inversin Partial Recombinant Protein (H00027130-Q01) (0)

There are no publications for Inversin Partial Recombinant Protein (H00027130-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Inversin Partial Recombinant Protein (H00027130-Q01) (0)

There are no reviews for Inversin Partial Recombinant Protein (H00027130-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Inversin Partial Recombinant Protein (H00027130-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array H00027130-Q01

Bioinformatics Tool for Inversin Partial Recombinant Protein (H00027130-Q01)

Discover related pathways, diseases and genes to Inversin Partial Recombinant Protein (H00027130-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Inversin Partial Recombinant Protein (H00027130-Q01)

Discover more about diseases related to Inversin Partial Recombinant Protein (H00027130-Q01).
 

Pathways for Inversin Partial Recombinant Protein (H00027130-Q01)

View related products by pathway.

PTMs for Inversin Partial Recombinant Protein (H00027130-Q01)

Learn more about PTMs related to Inversin Partial Recombinant Protein (H00027130-Q01).

Blogs on Inversin

There are no specific blogs for Inversin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Inversin RNAi
H00027130-R01-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Inversin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol INVS