Intelectin-2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Intelectin-2 Antibody [NBP1-81738] - Staining in human small intestine and liver tissues using anti-ITLN2 antibody. Corresponding ITLN2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Intelectin-2 Antibody [NBP1-81738] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells(goblet cells).

Immunohistochemistry-Paraffin: Intelectin-2 Antibody [NBP1-81738] - Staining of human duodenum shows strong extracellular positivity in goblet cells.

Immunohistochemistry-Paraffin: Intelectin-2 Antibody [NBP1-81738] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Intelectin-2 Antibody [NBP1-81738] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Discontinued

Intelectin-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TCAFSFSSLPRSCKEIKERCHSAGDGLYFLRTKNGVVY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITLN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Intelectin-2 Antibody - BSA Free

• HL-2
• intelectin 2
• Intelectin2
• Intelectin-2
• Intelectin-b
• Itln1b
• ITLN2
• Itlnb
• UNQ2789/PRO7179

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITLN2