INPP5F Antibody - BSA Free

Western Blot: INPP5F Antibody [NBP2-84093] - Host: Rabbit. Target Name: INPP5F. Sample Type: NCI-H226 Whole cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

INPP5F Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit INPP5F Antibody - BSA Free (NBP2-84093) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human INPP5F. Peptide sequence: VCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INPP5F
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for INPP5F Antibody - BSA Free

• EC 3.1.3
• EC 3.1.3.-
• EC 3.1.3.16
• EC 3.1.3.36
• FLJ13081
• hSAC2
• Inositol polyphosphate 5-phosphatase F
• inositol polyphosphate-5-phosphatase F
• KIAA0966MGC59773
• MGC131851
• phosphatidylinositide phosphatase SAC2
• Sac domain-containing inositol phosphatase 2
• Sac domain-containing phosphoinositide 5-phosphatase 2
• SAC2MSTPO47

Background

INPP5F is encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase and contains a Sac domain. The activity of this protein is specific for phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate. Alternatively spliced transcript variants have been observed, but most of them are not thought to be protein-coding. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INPP5F