Home » INPP5A » INPP5A Antibodies » INPP5A Antibody (3D8)

INPP5A Antibody (3D8)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunoprecipitation: INPP5A Antibody (3D8) [H00003632-M05] - Analysis of INPP5A transfected lysate using anti-INPP5A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with INPP5A rabbit polyclonal antibody.
Immunoprecipitation: INPP5A Antibody (3D8) [H00003632-M05] - Analysis of INPP5A transfected lysate using anti-INPP5A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with INPP5A rabbit polyclonal ...read more
Sandwich ELISA: INPP5A Antibody (3D8) [H00003632-M05] - Detection limit for recombinant GST tagged INPP5A is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, IP, S-ELISA
Clone
3D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

INPP5A Antibody (3D8) Summary

Immunogen
INPP5A (NP_005530, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW
Specificity
INPP5A - inositol polyphosphate-5-phosphatase, 40kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
INPP5A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC-P usage was reported in scientific literature. Use in Immunohistochemistry reported in scientific literature (PMID: 30359624).
Publications
Read Publications using
H00003632-M05 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INPP5A Antibody (3D8)

  • 43 kDa inositol polyphosphate 5-phophatase
  • CTCL tumor antigen HD-CL-02,5PTASE
  • DKFZp434A1721
  • EC 3.1.3.56
  • inositol polyphosphate-5-phosphatase, 40kD
  • inositol polyphosphate-5-phosphatase, 40kDa
  • inositol trisphosphate-5-phosphatase, 40kD
  • InsP3 5-phosphatase
  • MGC116947,5PTase
  • MGC116949
  • type I inositol-14,5-trisphosphate 5-phophatase
  • type I inositol-14,5-trisphosphate 5-phosphatase

Background

The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
INPP5B Antibody
NBP1-31705
Immunohistochemistry-Paraffin: INPP5B Antibody [NBP1-31705] - Paraffin-embedded Ca922 xenograft, using antibody at 1:100 dilution.
Western Blot: INPP5B Antibody [NBP1-31705] - Sample (30 ug of whole cell lysate) A: H1299 7. 5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: IHC, IHC-P, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
RPLP2 Antibody
NBP2-15104
Immunocytochemistry/Immunofluorescence: RPLP2 Antibody [NBP2-15104] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPLP2 Antibody [NBP2-15104] - Human colon carcinoma, using RPLP2 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: RPLP2 Antibody [NBP2-15104] - Sample (30 ug of whole cell lysate) A: 293T 15% SDS PAGE diluted at 1:10000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

FABP8/M-FABP/Myelin P2
AF5866
Western blot shows lysates of human hippocampal and rat spinal cord tissue. PVDF membrane was probed with 1 µg/mL of Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for FABP8 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 7.
FABP8 was detected in immersion fixed paraffin-embedded sections of human spinal cord using 15 µg/mL Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) overnight at 4 °C. Tissue was stained with the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
FABP8 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, WB
MBP Antibody (12)
NB600-717
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse spinal cord ventral white matter. Image from verified customer review.
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse brain corpus callosum. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MBP Antibody (12) [NB600-717] - Histological and mRNA analysis of the inflammatory cytokines in the vehicle- or etifoxine-treated mice at onset of clinical symptoms. At day 10 p.i., drug treated animals showed significant differences in MBP staining. Animals treated with etifoxine showed an increase in retention of percentage of MBP coverage (*p = 0.001). Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201202124), licensed under a CC-BY licence.
(3 Reviews)
(29 Publications)
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
MBL Antibody
AF2307
MBL Antibody
(6 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Ataxin-2 Antibody
NBP1-90063
Immunocytochemistry/Immunofluorescence: Ataxin-2 Antibody [NBP1-90063] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PRG2 Antibody
NBP3-04784
Western Blot: PRG2 Antibody [NBP3-04784] - Analysis of extracts of Mouse liver, using PRG2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: PRG2 Antibody [NBP3-04784] - Human placenta using PRG2 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/Immunofluorescence: PRG2 Antibody [NBP3-04784] - Immunofluorescence analysis of C6 cells using PRG2 Rabbit pAb (NBP3-04784) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(28 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
LMOD1 Antibody
NBP1-89396
Immunocytochemistry/Immunofluorescence: LMOD1 Antibody [NBP1-89396] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human prostate shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ITPKA Antibody
NBP1-81590
Immunohistochemistry: ITPKA Antibody [NBP1-81590] - Staining of mouse hippocampus shows positivity in astrocytes.
Immunohistochemistry: ITPKA Antibody [NBP1-81590] - Staining of mouse hypothalamus shows positivity in astrocyte end feet accentuated around blood vessels.
Immunohistochemistry: ITPKA Antibody [NBP1-81590] - Staining of mouse subiculum shows immunoreactivity in astrocytes.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Neurexophilin-1
Antibody
AF4208
Neurexophilin-1 Antibody
(1 Publication)
Species: Rt
Applications: WB
PIP5K1 alpha
Antibody
NBP2-19833
Immunohistochemistry-Paraffin: PIP5K1 alpha Antibody [NBP2-19833] - CL1-0 xenograft, using PIPK I alpha antibody at 1:100 dilution.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunocytochemistry/Immunofluorescence: PIP5K1 alpha Antibody [NBP2-19833] - Immunofluorescence analysis of methanol-fixed A549, using antibody at 1:500 dilution.
Western Blot: PIP5K1 alpha Antibody [NBP2-19833] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with PIP5K1A antibody [N1N3] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western lane view shows lysates of Raji human Burkitt's lymphoma cell line untreated (-) or treated (+) with 0.2 mg/mL Pervanadate (PV) for 30 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-PYK2/FAK2 (Y402) at approximately 113 kDa (as indicated) using 5 µg/mL of Mouse Anti-Human Phospho-PYK2/FAK2 (Y402) Monoclonal Antibody (Catalog # MAB6210). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of Raji human Burkitt's lymphoma cell line and Jurkat human acute T cell leukemia cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 30 minutes and 10 µg/mL Mouse Anti-Human CD3 epsilon Monoclonal Antibody (Catalog # MAB100) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Phospho-PYK2/FAK2 (Y402) Monoclonal Antibody (Catalog # MAB6210) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for Phospho-PYK2/FAK2 (Y402) at approximately 105-115 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: Simple Western, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Calmodulin antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Nephronophthisis
Antibody
NBP2-94059
Western Blot: Nephronophthisis Antibody [NBP2-94059] - Analysis of extracts of Mouse pancreas, using NPHP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.
Western Blot: Nephronophthisis Antibody [NBP2-94059] - Analysis of extracts of Mouse pancreas, using NPHP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: Nephronophthisis Antibody [NBP2-94059] - Rat kidney using NPHP1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FANCG Antibody
(2C8)
H00002189-M01
Western Blot: FANCG Antibody (2C8) [H00002189-M01] - Analysis of FANCG expression in transfected 293T cell line by FANCG monoclonal antibody (M01), clone 2C8.Lane 1: FANCG transfected lysate(68.6 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: FANCG Antibody (2C8) [H00002189-M01] - Analysis of monoclonal antibody to FANCG on HeLa cell. Antibody concentration 10 ug/ml.
Immunoprecipitation: FANCG Antibody (2C8) [H00002189-M01] - Analysis of FANCG transfected lysate using anti-FANCG monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FANCG MaxPab rabbit polyclonal antibody.
(5 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.A2058 melanoma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. C6 glioma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. HeLa Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
INPP5A Antibody
(3D8)
H00003632-M05
INPP5A Antibody (3D8)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA

Publications for INPP5A Antibody (H00003632-M05)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, IHC-P.


Filter By Application
IHC
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for INPP5A Antibody (H00003632-M05) (0)

There are no reviews for INPP5A Antibody (H00003632-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INPP5A Antibody (H00003632-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INPP5A Products

Bioinformatics Tool for INPP5A Antibody (H00003632-M05)

Discover related pathways, diseases and genes to INPP5A Antibody (H00003632-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP5A Antibody (H00003632-M05)

Discover more about diseases related to INPP5A Antibody (H00003632-M05).
 

Pathways for INPP5A Antibody (H00003632-M05)

View related products by pathway.

PTMs for INPP5A Antibody (H00003632-M05)

Learn more about PTMs related to INPP5A Antibody (H00003632-M05).
 

Research Areas for INPP5A Antibody (H00003632-M05)

Find related products by research area.

Blogs on INPP5A

There are no specific blogs for INPP5A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INPP5A Antibody (3D8) and receive a gift card or discount.


Bioinformatics

Gene Symbol INPP5A
Entrez
OMIM
Uniprot