Home » INPP5A » INPP5A Antibodies » INPP5A Antibody (3D8)

INPP5A Antibody (3D8)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: INPP5A Antibody (3D8) [H00003632-M05] - Detection limit for recombinant GST tagged INPP5A is 0.1 ng/ml as a capture antibody.
Sandwich ELISA: INPP5A Antibody (3D8) [H00003632-M05] - Detection limit for recombinant GST tagged INPP5A is 0.1 ng/ml as a capture antibody.
Immunoprecipitation: INPP5A Antibody (3D8) [H00003632-M05] - Analysis of INPP5A transfected lysate using anti-INPP5A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with INPP5A rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, IP
Clone
3D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

INPP5A Antibody (3D8) Summary

Immunogen
INPP5A (NP_005530, 288 a.a. - 387 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW
Specificity
INPP5A - inositol polyphosphate-5-phosphatase, 40kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
INPP5A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC-P usage was reported in scientific literature.
Publications
Read Publications using
H00003632-M05 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INPP5A Antibody (3D8)

  • 43 kDa inositol polyphosphate 5-phophatase
  • CTCL tumor antigen HD-CL-02,5PTASE
  • DKFZp434A1721
  • EC 3.1.3.56
  • inositol polyphosphate-5-phosphatase, 40kD
  • inositol polyphosphate-5-phosphatase, 40kDa
  • inositol trisphosphate-5-phosphatase, 40kD
  • InsP3 5-phosphatase
  • MGC116947,5PTase
  • MGC116949
  • type I inositol-14,5-trisphosphate 5-phophatase
  • type I inositol-14,5-trisphosphate 5-phosphatase

Background

The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBS9 Antibody
NBP1-88927
Western Blot: BBS9 Antibody [NBP1-88927] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
INPP5B Antibody
NBP1-89439
Immunocytochemistry/Immunofluorescence: INPP5B Antibody [NBP1-89439] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: INPP5B Antibody [NBP1-89439] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
RPLP2 Antibody
NBP2-15104
Western Blot: RPLP2 Antibody [NBP2-15104] - Sample (30 ug of whole cell lysate) A: 293T 15% SDS PAGE diluted at 1:10000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RPLP2 Antibody [NBP2-15104] - Analysis of methanol-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPLP2 Antibody [NBP2-15104] - Paraffin-embedded Colon ca, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

FABP8/M-FABP/Myelin P2
AF5866
Western blot shows lysates of human hippocampal and rat spinal cord tissue. PVDF membrane was probed with 1 µg/mL of Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for FABP8 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 7.
FABP8 was detected in immersion fixed paraffin-embedded sections of human spinal cord using 15 µg/mL Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) overnight at 4 °C. Tissue was stained with the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
FABP8 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Human FABP8 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5866) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
MBP Antibody (12)
NB600-717
Western Blot: MBP Antibody (12) [NB600-717] - Mouse Brain Tissue lysate probed with Rat anti MBP.
(1 Review)
(16 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
HBsAg Antibody
(3E7)
NBP1-22568
Immunohistochemistry-Paraffin: HBsAg Antibody (3E7) [NBP1-22568] - Human liver.
(1 Publication)
Species: Hu
Applications: IHC-P
Ataxin-2 Antibody
NBP1-90063
Western Blot: Ataxin-2 Antibody [NBP1-90063] - Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Ataxin-2 Antibody [NBP1-90063] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ataxin-2 Antibody [NBP1-90063] - Staining of human colon, kidney, skeletal muscle and testis using Anti-ATXN2 antibody NBP1-90063 (A) shows similar protein distribution across tissues to independent antibody NBP1-90062 (B).
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PRG2 Antibody
NBP1-88573
Western Blot: PRG2 Antibody [NBP1-88573] - Analysis in control (vector only transfected HEK293T lysate) and pRG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: PRG2 Antibody [NBP1-88573] - Staining of human skeletal muscle shows no cytoplasmic positivity as expected.
Immunohistochemistry-Paraffin: PRG2 Antibody [NBP1-88573] - Staining of human placenta shows moderate to strong cytoplasmic positivity in extra villous trophoblast.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
LMOD1 Antibody
NBP1-89396
Western Blot: LMOD1 Antibody [NBP1-89396] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: LMOD1 Antibody [NBP1-89396] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human smooth muscle.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ITPKA Antibody
NBP1-81590
Western Blot: ITPKA Antibody [NBP1-81590] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/Immunofluorescence: ITPKA Antibody [NBP1-81590] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry: ITPKA Antibody [NBP1-81590] - Staining of mouse subiculum shows immunoreactivity in astrocytes.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Neurexophilin-1
Antibody
AF4208
Neurexophilin-1 Antibody
(1 Publication)
Species: Rt
Applications: WB
PIP5K1 alpha
Antibody
NBP2-19833
Western Blot: PIP5K1 alpha Antibody [NBP2-19833] - Sample (30 ug of whole cell lysate) A: A431 B: H1299 C: Hela 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PIP5K1 alpha Antibody [NBP2-19833] - Immunofluorescence analysis of methanol-fixed A549, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: PIP5K1 alpha Antibody [NBP2-19833] - Immunohistochemical analysis of paraffin-embedded CL1-0 xenograft, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PYK2/FAK2 Antibody
NBP1-91228
Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Analysis using Anti-PTK2B antibody NBP1-91228 (A) shows similar pattern to independent antibody NBP1-91227 (B).
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody [NBP1-91228] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Analysis in human cell lines A-431 and HEK293 using anti-PTK2B antibody. Corresponding PTK2B RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
(1 Review)
(1 Publication)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Calmodulin 2
Knockout HeLa Cell Ly
NBP2-66296
Calmodulin 2 Knockout HeLa Cell Lysate
Species: Hu
Nephronophthisis
Antibody
H00004867-D01P
Western Blot: Nephronophthisis Antibody [H00004867-D01P] - Analysis of NPHP1 expression in mouse testis.
Western Blot: Nephronophthisis Antibody [H00004867-D01P] - Analysis of NPHP1 expression in A-431.
Western Blot: Nephronophthisis Antibody [H00004867-D01P] - Analysis of NPHP1 expression in transfected 293T cell line by NPHP1 polyclonal antibody.Lane 1: NPHP1 transfected lysate(14.30 KDa).Lane 2: Non-transfected lysate.
Species: Hu, Mu
Applications: WB
FANCG Antibody
NB100-2566
Western Blot: FANCG Antibody [NB100-2566] - Detection of FANC G in transfected COS1 cell lysate.
(4 Publications)
Species: Hu
Applications: WB
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
INPP5A Antibody
(3D8)
H00003632-M05
INPP5A Antibody (3D8)
Species: Hu
Applications: WB, ELISA, IHC-P, IP

Publications for INPP5A Antibody (H00003632-M05)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, IHC-P.


Filter By Application
IHC
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for INPP5A Antibody (H00003632-M05) (0)

There are no reviews for INPP5A Antibody (H00003632-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INPP5A Antibody (H00003632-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for INPP5A Antibody (H00003632-M05)

Discover related pathways, diseases and genes to INPP5A Antibody (H00003632-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP5A Antibody (H00003632-M05)

Discover more about diseases related to INPP5A Antibody (H00003632-M05).
 

Pathways for INPP5A Antibody (H00003632-M05)

View related products by pathway.

PTMs for INPP5A Antibody (H00003632-M05)

Learn more about PTMs related to INPP5A Antibody (H00003632-M05).
 

Research Areas for INPP5A Antibody (H00003632-M05)

Find related products by research area.

Blogs on INPP5A

There are no specific blogs for INPP5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INPP5A Antibody (3D8) and receive a gift card or discount.


Bioinformatics

Gene Symbol INPP5A
Entrez
OMIM
Uniprot