INPP5A Antibody (3D8)

Images

 
Sandwich ELISA: INPP5A Antibody (3D8) [H00003632-M05] - Detection limit for recombinant GST tagged INPP5A is 0.1 ng/ml as a capture antibody.
Immunoprecipitation: INPP5A Antibody (3D8) [H00003632-M05] - Analysis of INPP5A transfected lysate using anti-INPP5A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with INPP5A rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, IP
Clone
3D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

INPP5A Antibody (3D8) Summary

Immunogen
INPP5A (NP_005530, 288 a.a. - 387 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW
Specificity
INPP5A - inositol polyphosphate-5-phosphatase, 40kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
INPP5A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC-P usage was reported in scientific literature.
Publications
Read Publication using
H00003632-M05 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for INPP5A Antibody (3D8)

  • 43 kDa inositol polyphosphate 5-phophatase
  • CTCL tumor antigen HD-CL-02,5PTASE
  • DKFZp434A1721
  • EC 3.1.3.56
  • inositol polyphosphate-5-phosphatase, 40kD
  • inositol polyphosphate-5-phosphatase, 40kDa
  • inositol trisphosphate-5-phosphatase, 40kD
  • InsP3 5-phosphatase
  • MGC116947,5PTase
  • MGC116949
  • type I inositol-14,5-trisphosphate 5-phophatase
  • type I inositol-14,5-trisphosphate 5-phosphatase

Background

The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89439
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81590
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4208
Species: Rt
Applications: WB
NBP2-19833
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
H00004867-D01P
Species: Hu, Mu
Applications: WB
H00002189-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
H00003632-M05
Species: Hu
Applications: WB, ELISA, IHC-P, IP

Publications for INPP5A Antibody (H00003632-M05)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for INPP5A Antibody (H00003632-M05) (0)

There are no reviews for INPP5A Antibody (H00003632-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for INPP5A Antibody (H00003632-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional INPP5A Products

Bioinformatics Tool for INPP5A Antibody (H00003632-M05)

Discover related pathways, diseases and genes to INPP5A Antibody (H00003632-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INPP5A Antibody (H00003632-M05)

Discover more about diseases related to INPP5A Antibody (H00003632-M05).
 

Pathways for INPP5A Antibody (H00003632-M05)

View related products by pathway.

PTMs for INPP5A Antibody (H00003632-M05)

Learn more about PTMs related to INPP5A Antibody (H00003632-M05).
 

Research Areas for INPP5A Antibody (H00003632-M05)

Find related products by research area.

Blogs on INPP5A

There are no specific blogs for INPP5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our INPP5A Antibody (3D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol INPP5A
Entrez
OMIM
Uniprot