INAVA Antibody - BSA Free

Analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-C1orf106 antibody. Corresponding C1orf106 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.

Simple Western: C1orf106 Antibody [NBP1-90424] - C1orf106 Antibody [NBP1-90424] - Simple Western lane view shows a specific band for C1orf106 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: C1orf106 Antibody [NBP1-90424] - C1orf106 Antibody [NBP1-90424] - Electropherogram image(s) of corresponding Simple Western lane view. C1orf106 antibody was used at 1:60 dilution on RT-4 lysate(s).

• Reactivity: Hu
• Applications: WB, Simple Western
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

INAVA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit INAVA Antibody - BSA Free (NBP1-90424) is a polyclonal antibody validated for use in WB and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPQTLEGLQPTGPEAGSPERAPVQNSPWKETSLDHPYEKPRKSSEPWSESSSPATTPQDGPSASSLWLLEPASYHVVPIRG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C1ORF106
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Simple Western 1:60
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:60, apparent MW was 100 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  INAVA Recombinant Protein Antigen (NBP1-90424PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for INAVA Antibody - BSA Free

• C1orf106
• chromosome 1 open reading frame 106
• hypothetical protein LOC55765

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C1ORF106