Ift80 Antibody

Images

 
Immunohistochemistry-Paraffin: Ift80 Antibody [NBP1-92020] - Staining of human kidney shows strong cytoplasmic positivity with a granular pattern in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ift80 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EELYSCSDDHQIVKWNLLTSETTQIVKLPDDIYPIDFHWFPKSLGVKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHCGAVLAGRWNY
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ift80 Protein (NBP1-92020PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ift80 Antibody

  • ATD2
  • intraflagellar transport 80 homolog (Chlamydomonas)
  • intraflagellar transport protein 80 homolog
  • KIAA1374WDR56WD repeat domain 56
  • MGC126543
  • WD repeat-containing protein 56

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82884
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-02056
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1216
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-92581
Species: Hu
Applications: IHC, IHC-P
NBP1-84038
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2475
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP2-16925
Species: Hu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
NBP2-02313
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-46159
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-84880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84671
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89910
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, Simple Western, Single-Cell Western, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3635
Species: Mu
Applications: IHC, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
NBP2-46524
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92020
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Ift80 Antibody (NBP1-92020) (0)

There are no publications for Ift80 Antibody (NBP1-92020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ift80 Antibody (NBP1-92020) (0)

There are no reviews for Ift80 Antibody (NBP1-92020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Ift80 Antibody (NBP1-92020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ift80 Products

Array NBP1-92020

Bioinformatics Tool for Ift80 Antibody (NBP1-92020)

Discover related pathways, diseases and genes to Ift80 Antibody (NBP1-92020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ift80 Antibody (NBP1-92020)

Discover more about diseases related to Ift80 Antibody (NBP1-92020).
 

Pathways for Ift80 Antibody (NBP1-92020)

View related products by pathway.

Blogs on Ift80

There are no specific blogs for Ift80, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ift80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT80