Ift80 Antibody

Images

 
Western Blot: Ift80 Antibody [NBP1-74179] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ift80 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Ift80. Immunizing peptide sequence PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Ift80 and was validated on Western blot.
Theoretical MW
85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ift80 Antibody

  • ATD2
  • intraflagellar transport 80 homolog (Chlamydomonas)
  • intraflagellar transport protein 80 homolog
  • KIAA1374WDR56WD repeat domain 56
  • MGC126543
  • WD repeat-containing protein 56

Background

Ift80 is a component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82884
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-02056
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1216
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-92581
Species: Hu
Applications: IHC, IHC-P
NBP1-84038
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2475
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP2-16925
Species: Hu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
NBP2-02313
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-46159
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-84880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84671
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89910
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, Simple Western, Single-Cell Western, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3635
Species: Mu
Applications: IHC, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
NBP2-46524
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-74179
Species: Mu
Applications: WB

Publications for Ift80 Antibody (NBP1-74179) (0)

There are no publications for Ift80 Antibody (NBP1-74179).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ift80 Antibody (NBP1-74179) (0)

There are no reviews for Ift80 Antibody (NBP1-74179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ift80 Antibody (NBP1-74179) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ift80 Products

Array NBP1-74179

Bioinformatics Tool for Ift80 Antibody (NBP1-74179)

Discover related pathways, diseases and genes to Ift80 Antibody (NBP1-74179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ift80 Antibody (NBP1-74179)

Discover more about diseases related to Ift80 Antibody (NBP1-74179).
 

Pathways for Ift80 Antibody (NBP1-74179)

View related products by pathway.

Blogs on Ift80

There are no specific blogs for Ift80, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ift80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT80
Uniprot