Home » Ift80 » Ift80 Antibodies » Ift80 Antibody

Ift80 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Ift80 Antibody [NBP1-74179] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%
Western Blot: Ift80 Antibody [NBP1-74179] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Ift80 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Ift80. Immunizing peptide sequence PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Ift80 and was validated on Western blot.
Theoretical MW
85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ift80 Antibody

  • ATD2
  • intraflagellar transport 80 homolog (Chlamydomonas)
  • intraflagellar transport protein 80 homolog
  • KIAA1374WDR56WD repeat domain 56
  • MGC126543
  • WD repeat-containing protein 56

Background

Ift80 is a component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DYNC2H1 Antibody
NBP1-94086
Immunocytochemistry/Immunofluorescence: DYNC2H1 Antibody [NBP1-94086] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DYNC2H1 Antibody [NBP1-94086] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NEK1 Antibody
NBP1-82884
Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Analysis in human testis and skin tissues. Corresponding NEK1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human endometrium shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human Fallopian tube shows strong cytoplasmic/ membranous positivity in glandular cells.
(1 Review)
Species: Hu, Mu
Applications: IHC, IHC-P
Phosphoribosyl
Pyrophosphate Amidotr ...
NBP2-02056
Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody (OTI1B8) [NBP2-02056] - Analysis of extracts (35ug) from 9 different cell lines by usin g anti-Phosphoribosyl Pyrophosphate Amidotransferase monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody (OTI1B8) [NBP2-02056] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-Phosphoribosyl Pyrophosphate Amidotransferase mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody (OTI1B8) [NBP2-02056] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Phosphoribosyl Pyrophosphate Amidotransferase mouse monoclonal antibody.
(1 Publication)
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
EVC2 Antibody
NB100-1216
Immunohistochemistry-Paraffin: EVC2 Antibody [NB100-1216] - (3.8ug/ml) staining of paraffin embedded Human Placenta. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
WDR35 Antibody
NBP1-92581
Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WDR35 Antibody [NBP1-92581] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: IHC, IHC-P
Ellis van Creveld
syndrome Antibody
NBP1-84038
Immunocytochemistry/Immunofluorescence: Ellis van Creveld syndrome Antibody [NBP1-84038] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Ellis van Creveld syndrome Antibody [NBP1-84038] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Ellis van Creveld syndrome Antibody [NBP1-84038] - Staining of human endometrium shows weak granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
IFT88 Antibody
NB100-2475
Flow Cytometry: IFT88 Antibody [NB100-2475] - Analysis of paraformaldehyde fixed HepG2 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Western Blot: IFT88 Antibody [NB100-2475] - Staining of A549 (A) cell lysate and Mouse Testes (B) lysate (35 ug protein in RIPA buffer). Antibody at 3 ug/mL. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: IFT88 Antibody [NB100-2475] - Analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(4 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
IFT122 Antibody
NBP2-16925
Western Blot: IFT122 Antibody [NBP2-16925] - Sample (30 ug of whole cell lysate) A: 293T 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: IFT122 Antibody [NBP2-16925] - Immunohistochemical analysis of paraffin-embedded hepatoma, using antibody at 1:500 dilution.
Immunocytochemistry/Immunofluorescence: IFT122 Antibody [NBP2-16925] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Species: Hu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
HIPPI Antibody
(OTI4F6)
NBP2-02313
Western Blot: HIPPI Antibody (4F6) [NBP2-02313] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HIPPI (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HIPPI.
Immunohistochemistry-Paraffin: HIPPI Antibody (4F6) [NBP2-02313] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-HIPPI mouse monoclonal antibody.
Immunohistochemistry-Paraffin: HIPPI Antibody (4F6) [NBP2-02313] - Staining of paraffin-embedded Adenocarcinoma of ovary tissue using anti-HIPPI mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RNF7 Antibody
NBP1-46159
Immunohistochemistry-Paraffin: RNF7 Antibody [NBP1-46159] - Staining of Human Kidney. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: RNF7 Antibody [NBP1-46159] - Human Heart lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
SLC25A22 Antibody
NBP1-84880
Immunocytochemistry/Immunofluorescence: SLC25A22 Antibody [NBP1-84880] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: SLC25A22 Antibody [NBP1-84880] - Staining of human cerebral cortex shows strong granular positivity in cytoplasm in neurons.
Immunohistochemistry-Paraffin: SLC25A22 Antibody [NBP1-84880] - Staining of human prostate shows strong granular positivity in cytoplasm in glandular cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FoxM1 Antibody
NBP1-84671
Western Blot: FoxM1 Antibody [NBP1-84671] - Primary AML mononuclear cells were obtained from patients with newly diagnosed or relapsed AML. Mononuclear cells were supplemented by CD34 expansion supplement for 24 hours in the presence of drug or 0.1% DMSO. Cells were then harvested for Western blot. Treated cells were harvested and lysed using IP buffer. Protein concentration was determined. Isolated proteins were separated on SDS-PAGE and transferred to PVDF membrane. Immunoblotting was carried out with antibodies specific for FOXM1 and B-actin. This image was submitted via customer review.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human rectum shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
ITF46 Antibody
NBP1-89910
Immunohistochemistry-Paraffin: ITF46 Antibody [NBP1-89910] - Staining of human bronchus shows moderate cytoplasmic and membrane positivity in respiratory epithelial cells.
(2 Publications)
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P
OLFM4 Antibody -
BSA Free
NBP2-24535
Western Blot: OLFM4 Antibody [NBP2-24535] - Analysis of human OLFM4 in human liver lysate in the 1) absence and 2) presence of immunizing peptide using OLFM4 antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: OLFM4 Antibody [NBP2-24535] - Analysis of OLFM4 in formalin-fixed, paraffin-embedded human liver tissue using OLFM4 antibody at 5 ug/ml.
Simple Western: OLFM4 Antibody [NBP2-24535] - Simple Western lane view shows a specific band for OLMF4 in 0.2 mg/ml of Human Liver (left) and Mouse Liver (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. *Non-specific interaction with the 230 kDa standard may be seen with this antibody.
(4 Publications)
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, Simple Western, Single-Cell Western, WB
SMOX Antibody
NBP3-04509
Immunohistochemistry-Paraffin: SMOX Antibody [NBP3-04509] - Immunohistochemistry of paraffin-embedded mouse testis using SMOX Rabbit pAb (NBP3-04509) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot: SMOX Antibody [NBP3-04509] - Western blot analysis of extracts of various cell lines, using SMOX antibody (NBP3-04509) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: SMOX Antibody [NBP3-04509] - Immunohistochemistry of paraffin-embedded rat brain using SMOX Rabbit pAb (NBP3-04509) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
GLI-2 Antibody
AF3635
GLI‑2 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Mouse GLI‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3635) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling when primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(17 Publications)
Species: Mu
Applications: IHC, WB
GLI-1 Antibody -
BSA Free
NB600-600
Immunohistochemistry-Paraffin: GLI-1 Antibody [NB600-600] - Staining in canine hair follicle. Image from a verified customer review.
Knockdown Validated: GLI-1 Antibody - BSA Free [NB600-600] - GLI-1 Antibody [NB600-600] - Inhibition of Hh signaling in CAFs blocks its effects on lymphangiogenesis in vivo and in vitro. (E) IHC staining for Ki-67, -SMA, Gli-1 and LYVE1 in tumour sections from mice in the two groups. Human CAFs promote lymphangiogenesis in ovarian cancer via the Hh-VEGF-C signaling axis. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31012844/) licensed under a CC-BY licence.
Flow (Intracellular): GLI-1 Antibody [NB600-600] - Staining for GLI-1 in untreated human B cell lines (BCWM.1, MWCL-1 and RPCI-WM1) using anti-GLI-1 antibody. Rabbit IgG Isotype Control (Cat# NBP2-36463) was used as a negative control. Image courtesy of Sherine Elsawa, Northern Illinois University.
(1 Review)
(44 Publications)
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
ANKMY2 Antibody
(OTI1F11)
NBP2-46524
Immunohistochemistry: ANKMY2 Antibody (1F11) [NBP2-46524] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: ANKMY2 Antibody (1F11) [NBP2-46524] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: ANKMY2 Antibody (1F11) [NBP2-46524] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, WB
MTSS1 Antibody
NBP2-24716
Immunohistochemistry-Paraffin: MTSS1 Antibody [NBP2-24716] - Analysis of human colon using this antibody at 10 ug/ml.
Western Blot: MTSS1 Antibody [NBP2-24716] - Analysis of MTSS1 in human testis lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse and 4) rat testis lysate using NBP2-24716 at 2 ug/ml, 4 ug/ml and 2 ug/ml, respectively.
(1 Publication)
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Ift80 Antibody
NBP1-74179
Ift80 Antibody
Species: Mu
Applications: WB

Publications for Ift80 Antibody (NBP1-74179) (0)

There are no publications for Ift80 Antibody (NBP1-74179).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ift80 Antibody (NBP1-74179) (0)

There are no reviews for Ift80 Antibody (NBP1-74179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ift80 Antibody (NBP1-74179) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ift80 Products

Array NBP1-74179

Bioinformatics Tool for Ift80 Antibody (NBP1-74179)

Discover related pathways, diseases and genes to Ift80 Antibody (NBP1-74179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ift80 Antibody (NBP1-74179)

Discover more about diseases related to Ift80 Antibody (NBP1-74179).
 

Pathways for Ift80 Antibody (NBP1-74179)

View related products by pathway.

Blogs on Ift80

There are no specific blogs for Ift80, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ift80 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IFT80
Uniprot