IFT140 Antibody

Images

 
Immunohistochemistry-Paraffin: IFT140 Antibody [NBP2-14116] - Staining of human fallopian tube shows distinct positivity in ciliary rootlets.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFT140 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LWRLDQRGRVQGTPLLKHEYGKHLTHCIFRLPPPGEDLVQLAKAAVSGDE KALDMFNWKKSSSGSLLKMGSHEGLLFFVSLMDGTVHYVDEKGKTTQVVS ADSTIQMLFY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT140
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IFT140 Protein (NBP2-14116PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFT140 Antibody

  • FLJ30571
  • gs114
  • intraflagellar transport 140 homolog (Chlamydomonas)
  • intraflagellar transport protein 140 homolog
  • WDTC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-55756
Species: Hu
Applications: IHC-P
NBP2-02313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-46524
Species: Hu
Applications: WB, IHC
NBP2-16927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20891
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-86424
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14538
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14116
Species: Hu
Applications: IHC, IHC-P

Publications for IFT140 Antibody (NBP2-14116) (0)

There are no publications for IFT140 Antibody (NBP2-14116).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFT140 Antibody (NBP2-14116) (0)

There are no reviews for IFT140 Antibody (NBP2-14116). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IFT140 Antibody (NBP2-14116) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFT140 Products

IFT140 NBP2-14116

Bioinformatics Tool for IFT140 Antibody (NBP2-14116)

Discover related pathways, diseases and genes to IFT140 Antibody (NBP2-14116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFT140 Antibody (NBP2-14116)

Discover more about diseases related to IFT140 Antibody (NBP2-14116).
 

Pathways for IFT140 Antibody (NBP2-14116)

View related products by pathway.

Blogs on IFT140

There are no specific blogs for IFT140, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFT140 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT140