dynein, cytoplasmic 2, light intermediate chain 1 Antibody


Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol.
Immunohistochemistry-Paraffin: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-38008] - Staining of human fallopian tube shows strong positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

dynein, cytoplasmic 2, light intermediate chain 1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PENDIGKLHAHSPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLELEQYKRSSSKSWKQIEL
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
dynein, cytoplasmic 2, light intermediate chain 1 Protein (NBP2-38008PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for dynein, cytoplasmic 2, light intermediate chain 1 Antibody

  • CGI-60
  • cytoplasmic dynein 2 light intermediate chain 1
  • D2LICDKFZp564A033
  • DKFZP564A033
  • dynein, cytoplasmic 2, light intermediate chain 1
  • LIC3Dynein 2 light intermediate chain


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-P, IP
Species: Hu
Applications: WB, ChIP, ICC

Publications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-38008) (0)

There are no publications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-38008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-38008) (0)

There are no reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-38008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-38008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional dynein, cytoplasmic 2, light intermediate chain 1 Products

Bioinformatics Tool for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-38008)

Discover related pathways, diseases and genes to dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-38008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on dynein, cytoplasmic 2, light intermediate chain 1

There are no specific blogs for dynein, cytoplasmic 2, light intermediate chain 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our dynein, cytoplasmic 2, light intermediate chain 1 Antibody and receive a gift card or discount.


Gene Symbol DYNC2LI1