IFN-omega/IFNW1 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 22-195 of human IFN-omega/IFNW1 (NP_002168.1). LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
IFNW1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50-1:100
- Immunohistochemistry-Paraffin
- Western Blot 1:500-1:2000
|
Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for IFN-omega/IFNW1 Antibody - BSA Free
Background
IFNW1, also known as Interferon omega-1, is a 196 amino acid protein that is 22 kDa, belongs to the alpha/beta interferon family, with secreted subcellular location, and a little is currently known about its function. Current research is being performed on this protein involvement in interferon, dengue hemorrhagic fever, hemorrhagic fever, narcolepsy, melanoma, hepatitis c, and hepatitis b. IFNW1 protein involvement has been observed with relation to IFNAR1 and IFNAR2 in the cytokine-cytokine receptor interaction, RIG-I-like receptor signaling pathway, Jak-STAT signaling pathway, interferon pathway, and all-trans-retinoic acid mediated apoptosis pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Publications for IFN-omega/IFNW1 Antibody (NBP3-03585) (0)
There are no publications for IFN-omega/IFNW1 Antibody (NBP3-03585).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFN-omega/IFNW1 Antibody (NBP3-03585) (0)
There are no reviews for IFN-omega/IFNW1 Antibody (NBP3-03585).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IFN-omega/IFNW1 Antibody (NBP3-03585) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IFN-omega/IFNW1 Products
Research Areas for IFN-omega/IFNW1 Antibody (NBP3-03585)
Find related products by research area.
|
Blogs on IFN-omega/IFNW1