Recombinant Human IFITM1 Protein

Images

 
There are currently no images for IFITM1 Recombinant Protein (H00008519-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AP

Order Details

Recombinant Human IFITM1 Protein Summary

Description
An untagged recombinant protein corresponding to the amino acid sequence of (AAH00897.1) for Human IFITM1

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Preparation
Method
in vitro wheat germ expression system with proprietary liposome technology
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
IFITM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Immunoaffinity Purification
Theoretical MW
13.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
Glycerol
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IFITM1 Protein

  • CD225 antigen
  • CD225
  • CD225Leu-13 antigen
  • IFI17
  • IFI17LEU13,9-27
  • IFITM1
  • interferon induced transmembrane protein 1 (9-27)
  • Interferon-induced protein 17
  • interferon-induced transmembrane protein 1
  • Interferon-inducible protein 9-27
  • Leu-13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-72115
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP3-04444
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-91923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3377
Species: Mu
Applications: IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00010581-M14
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-93843
Species: Hu, Mu, Rt
Applications: WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP1-32905
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
UL-553
Species: Hu
Applications: EnzAct
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
H00008519-G01
Species: Hu
Applications: AP

Publications for IFITM1 Recombinant Protein (H00008519-G01) (0)

There are no publications for IFITM1 Recombinant Protein (H00008519-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFITM1 Recombinant Protein (H00008519-G01) (0)

There are no reviews for IFITM1 Recombinant Protein (H00008519-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IFITM1 Recombinant Protein (H00008519-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFITM1 Products

Bioinformatics Tool for IFITM1 Recombinant Protein (H00008519-G01)

Discover related pathways, diseases and genes to IFITM1 Recombinant Protein (H00008519-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFITM1 Recombinant Protein (H00008519-G01)

Discover more about diseases related to IFITM1 Recombinant Protein (H00008519-G01).
 

Pathways for IFITM1 Recombinant Protein (H00008519-G01)

View related products by pathway.

PTMs for IFITM1 Recombinant Protein (H00008519-G01)

Learn more about PTMs related to IFITM1 Recombinant Protein (H00008519-G01).
 

Research Areas for IFITM1 Recombinant Protein (H00008519-G01)

Find related products by research area.

Blogs on IFITM1

There are no specific blogs for IFITM1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IFITM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFITM1