IFITM1 Antibody

Images

 
Western Blot: IFITM1 Antibody [H00008519-D01P] - Analysis of IFITM1 expression in transfected 293T cell line by IFITM1 polyclonal antibody.Lane 1: IFITM1 transfected lysate(13.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFITM1 Antibody Summary

Immunogen
IFITM1 (AAH00897.1, 1 a.a. - 125 a.a.) full-length human protein. MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFITM1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFITM1 Antibody

  • CD225 antigen
  • CD225
  • CD225Leu-13 antigen
  • IFI17
  • IFI17LEU13,9-27
  • IFITM1
  • interferon induced transmembrane protein 1 (9-27)
  • Interferon-induced protein 17
  • interferon-induced transmembrane protein 1
  • Interferon-inducible protein 9-27
  • Leu-13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-33469
Species: Hu
Applications: IHC, IHC-P
NBP1-86846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3377
Species: Mu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00010581-B01P
Species: Hu
Applications: WB, ELISA
NBP2-30061
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready

Publications for IFITM1 Antibody (H00008519-D01P) (0)

There are no publications for IFITM1 Antibody (H00008519-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFITM1 Antibody (H00008519-D01P) (0)

There are no reviews for IFITM1 Antibody (H00008519-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFITM1 Antibody (H00008519-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFITM1 Products

Bioinformatics Tool for IFITM1 Antibody (H00008519-D01P)

Discover related pathways, diseases and genes to IFITM1 Antibody (H00008519-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFITM1 Antibody (H00008519-D01P)

Discover more about diseases related to IFITM1 Antibody (H00008519-D01P).
 

Pathways for IFITM1 Antibody (H00008519-D01P)

View related products by pathway.

PTMs for IFITM1 Antibody (H00008519-D01P)

Learn more about PTMs related to IFITM1 Antibody (H00008519-D01P).
 

Research Areas for IFITM1 Antibody (H00008519-D01P)

Find related products by research area.

Blogs on IFITM1

There are no specific blogs for IFITM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFITM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFITM1
Entrez
Uniprot