IFI27 Antibody

Images

 
Western Blot: IFI27 Antibody [H00003429-A01] - Detection against Immunogen (39.2 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFI27 Antibody Summary

Immunogen
IFI27 (AAH15492, 1 a.a. - 119 a.a.) full-length recombinant protein with GST tag. MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
Specificity
IFI27 - interferon, alpha-inducible protein 27
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IFI27
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Publications
Read Publication using H00003429-A01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFI27 Antibody

  • FAM14D
  • Interferon alpha-induced 11.5 kDa protein
  • interferon alpha-inducible protein 27, mitochondrial
  • interferon, alpha-inducible protein 27,2310061N23Rik
  • Interferon-stimulated gene 12a protein
  • ISG12
  • ISG12(a)
  • ISG12A
  • P27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-66154
Species: Hu
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29923
Species: Hu
Applications: WB, Flow

Publications for IFI27 Antibody (H00003429-A01)(1)

Reviews for IFI27 Antibody (H00003429-A01) (0)

There are no reviews for IFI27 Antibody (H00003429-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFI27 Antibody (H00003429-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for IFI27 Antibody (H00003429-A01)

Discover related pathways, diseases and genes to IFI27 Antibody (H00003429-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI27 Antibody (H00003429-A01)

Discover more about diseases related to IFI27 Antibody (H00003429-A01).
 

Pathways for IFI27 Antibody (H00003429-A01)

View related products by pathway.

PTMs for IFI27 Antibody (H00003429-A01)

Learn more about PTMs related to IFI27 Antibody (H00003429-A01).
 

Research Areas for IFI27 Antibody (H00003429-A01)

Find related products by research area.

Blogs on IFI27

There are no specific blogs for IFI27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFI27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFI27
Entrez
OMIM
Uniprot