Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen | IFI27 (AAH15492, 1 a.a. - 119 a.a.) full-length recombinant protein with GST tag. MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY |
Specificity | IFI27 - interferon, alpha-inducible protein 27 |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | IFI27 |
Purity | Unpurified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | 50 % glycerol |
Preservative | No Preservative |
Purity | Unpurified |
Publications using H00003429-A01 | Applications | Species |
---|---|---|
Nzeusseu Toukap A, Galant C, Theate I et al. Identification of distinct gene expression profiles in the synovium of patients with systemic lupus erythematosus. Arthritis Rheum. 2007-05-01 [PMID: 17469140] | ||
Mclean A, Tang B, Parnell GP et al. Risk Stratification in Influenza. United States Patent Application 2015-11-12 |
Secondary Antibodies |
Isotype Controls |
Diseases for IFI27 Antibody (H00003429-A01)Discover more about diseases related to IFI27 Antibody (H00003429-A01).
| Pathways for IFI27 Antibody (H00003429-A01)View related products by pathway.
|
PTMs for IFI27 Antibody (H00003429-A01)Learn more about PTMs related to IFI27 Antibody (H00003429-A01).
| Research Areas for IFI27 Antibody (H00003429-A01)Find related products by research area.
|
COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.