IER5L Antibody


Immunocytochemistry/ Immunofluorescence: IER5L Antibody [NBP1-88799] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

IER5L Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PSDFGLHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPGLASAAGCKRKYYPGQEEEEDDEEDAG
Specificity of human IER5L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IER5L Protein (NBP1-88799PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IER5L Antibody

  • bA247A12.2
  • immediate early response 5-like
  • immediate early response gene 5-like protein
  • MGC70833


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Rb
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IER5L Antibody (NBP1-88799) (0)

There are no publications for IER5L Antibody (NBP1-88799).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IER5L Antibody (NBP1-88799) (0)

There are no reviews for IER5L Antibody (NBP1-88799). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IER5L Antibody (NBP1-88799) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP1-88799

Bioinformatics Tool for IER5L Antibody (NBP1-88799)

Discover related pathways, diseases and genes to IER5L Antibody (NBP1-88799). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IER5L Antibody (NBP1-88799)

Discover more about diseases related to IER5L Antibody (NBP1-88799).

Pathways for IER5L Antibody (NBP1-88799)

View related products by pathway.

Blogs on IER5L

There are no specific blogs for IER5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IER5L Antibody and receive a gift card or discount.


Gene Symbol IER5L