IER5L Antibody

Images

 
Western Blot: IER5L Antibody [NBP1-74071] - Mouse Pancreas Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IER5L Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Ier5l. Immunizing peptide sequence TPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IER5L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ier5l and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IER5L Antibody

  • bA247A12.2
  • immediate early response 5-like
  • immediate early response gene 5-like protein
  • MGC70833

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6798
Species: Hu
Applications: WB, ICC
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
AF3075
Species: Hu
Applications: WB, ICC
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF1334
Species: Hu
Applications: WB, IHC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005670-T01
Species: Hu
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
NBP2-45912
Species: Hu
Applications: WB, IHC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IER5L Antibody (NBP1-74071) (0)

There are no publications for IER5L Antibody (NBP1-74071).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IER5L Antibody (NBP1-74071) (0)

There are no reviews for IER5L Antibody (NBP1-74071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IER5L Antibody (NBP1-74071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IER5L Products

IER5L NBP1-74071

Bioinformatics Tool for IER5L Antibody (NBP1-74071)

Discover related pathways, diseases and genes to IER5L Antibody (NBP1-74071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IER5L Antibody (NBP1-74071)

Discover more about diseases related to IER5L Antibody (NBP1-74071).
 

Pathways for IER5L Antibody (NBP1-74071)

View related products by pathway.

Blogs on IER5L

There are no specific blogs for IER5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IER5L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IER5L