Recombinant Human ICK Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ICK Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 192-292 of Human ICK

Source: Wheat Germ

Amino Acid Sequence: EVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQVFFHFLVITFISNSE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ICK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ICK Protein

  • EC 2.7.11
  • hICK
  • intestinal cell (MAK-like) kinase
  • Intestinal cell kinase
  • KIAA0936EC 2.7.11.22
  • Laryngeal cancer kinase 2
  • LCK2serine/threonine protein kinase
  • MAK-related kinase
  • MGC46090
  • MRKECO
  • serine/threonine-protein kinase ICK

Background

ICK - intestinal cell (MAK-like) kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
H00004117-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81417
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008706-P01
Species: Hu
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ICK Partial Recombinant Protein (H00022858-Q01) (0)

There are no publications for ICK Partial Recombinant Protein (H00022858-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICK Partial Recombinant Protein (H00022858-Q01) (0)

There are no reviews for ICK Partial Recombinant Protein (H00022858-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ICK Partial Recombinant Protein (H00022858-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ICK Partial Recombinant Protein (H00022858-Q01)

Discover related pathways, diseases and genes to ICK Partial Recombinant Protein (H00022858-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICK Partial Recombinant Protein (H00022858-Q01)

Discover more about diseases related to ICK Partial Recombinant Protein (H00022858-Q01).
 

Pathways for ICK Partial Recombinant Protein (H00022858-Q01)

View related products by pathway.

PTMs for ICK Partial Recombinant Protein (H00022858-Q01)

Learn more about PTMs related to ICK Partial Recombinant Protein (H00022858-Q01).
 

Research Areas for ICK Partial Recombinant Protein (H00022858-Q01)

Find related products by research area.

Blogs on ICK

There are no specific blogs for ICK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ICK Antibody
NBP2-23656

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ICK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ICK