IA-2/PTPRN Antibody

Images

 
Immunohistochemistry-Paraffin: IA-2/PTPRN Antibody [NBP1-83128] - Staining of adrenal gland shows strong cytoplasmic positivity in medullary cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IA-2/PTPRN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IA-2/PTPRN Protein (NBP1-83128PEP)
Publications
Read Publication using NBP1-83128.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IA-2/PTPRN Antibody

  • CA 512
  • EC 3.1.3.48
  • FLJ16131
  • IA2
  • IA-2
  • IA-2/PTP
  • ICA 512
  • ICA3
  • ICA512
  • islet cell antigen 2
  • Islet cell antigen 512
  • Islet cell autoantigen 3
  • protein tyrosine phosphatase, receptor type, N
  • protein tyrosine phosphatase-like N
  • PTP IA-2
  • PTPRN
  • receptor-type tyrosine-protein phosphatase-like N
  • R-PTP-N

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-81628
Species: Hu
Applications: WB, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF7318
Species: Hu
Applications: IHC
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-84164
Species: Hu
Applications: IHC, IHC-P
NBP1-86126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-81626
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32847
Species: Hu
Applications: WB, ICC/IF, IP
MAB7475
Species: Hu, Rt
Applications: WB
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP1-76307
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for IA-2/PTPRN Antibody (NBP1-83128)(1)

Reviews for IA-2/PTPRN Antibody (NBP1-83128) (0)

There are no reviews for IA-2/PTPRN Antibody (NBP1-83128). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IA-2/PTPRN Antibody (NBP1-83128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IA-2/PTPRN Products

Bioinformatics Tool for IA-2/PTPRN Antibody (NBP1-83128)

Discover related pathways, diseases and genes to IA-2/PTPRN Antibody (NBP1-83128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IA-2/PTPRN Antibody (NBP1-83128)

Discover more about diseases related to IA-2/PTPRN Antibody (NBP1-83128).
 

Pathways for IA-2/PTPRN Antibody (NBP1-83128)

View related products by pathway.

PTMs for IA-2/PTPRN Antibody (NBP1-83128)

Learn more about PTMs related to IA-2/PTPRN Antibody (NBP1-83128).
 

Research Areas for IA-2/PTPRN Antibody (NBP1-83128)

Find related products by research area.

Blogs on IA-2/PTPRN

There are no specific blogs for IA-2/PTPRN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IA-2/PTPRN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRN
Entrez