HYAL3 Antibody

Images

 
Western Blot: HYAL3 Antibody [H00008372-D01P] - Analysis of HYAL3 expression in mouse liver.
Western Blot: HYAL3 Antibody [H00008372-D01P] - Analysis of HYAL3 expression in transfected 293T cell line by HYAL3 polyclonal antibody.Lane 1: HYAL3 transfected lysate(46.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HYAL3 Antibody Summary

Immunogen
HYAL3 (AAH05896.1, 1 a.a. - 417 a.a.) full-length human protein. MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
Specificity
HYAL3 - hyaluronoglucosaminidase 3,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HYAL3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HYAL3 Antibody

  • EC 3.2.1.35
  • HYAL-3
  • hyaluronidase-3
  • hyaluronoglucosaminidase 3
  • Hyaluronoglucosaminidase-3
  • LUCA14
  • LuCa-3
  • LUCA3LUCA-3
  • Lung carcinoma protein 3
  • Minna14

Background

This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83409
Species: Hu
Applications: IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86328
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86355
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-81244
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00024142-D01P
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
H00008372-D01P
Species: Hu, Mu
Applications: WB

Publications for HYAL3 Antibody (H00008372-D01P) (0)

There are no publications for HYAL3 Antibody (H00008372-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HYAL3 Antibody (H00008372-D01P) (0)

There are no reviews for HYAL3 Antibody (H00008372-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HYAL3 Antibody (H00008372-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HYAL3 Products

Bioinformatics Tool for HYAL3 Antibody (H00008372-D01P)

Discover related pathways, diseases and genes to HYAL3 Antibody (H00008372-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HYAL3 Antibody (H00008372-D01P)

Discover more about diseases related to HYAL3 Antibody (H00008372-D01P).
 

Pathways for HYAL3 Antibody (H00008372-D01P)

View related products by pathway.

PTMs for HYAL3 Antibody (H00008372-D01P)

Learn more about PTMs related to HYAL3 Antibody (H00008372-D01P).

Blogs on HYAL3

There are no specific blogs for HYAL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HYAL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HYAL3
Entrez
Uniprot