HSFY1 Antibody

Images

 
Western Blot: HSFY1 Antibody [NBP1-80388] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSFY1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human HSFY1. Peptide sequence VSVNEAPYRNMLPAGNPWLQMPTIADRSAAPHSRLALQPSPLDKYHPNYN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSFY1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against HSFY1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HSFY1 Antibody

  • FLJ25453
  • Heat shock transcription factor 2-like protein
  • heat shock transcription factor, Y linked 2
  • heat shock transcription factor, Y-linked
  • HSF2L
  • HSF2-like
  • HSFY
  • HSFY1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
H00007258-Q01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-14944
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00201780-P01
Species: Hu
H00009426-Q01
Species: Hu
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-79749
Species: Hu
Applications: WB
22240002
Species: Hu
Applications: WB, ELISA
H00159119-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5227
Species: Hu, Mu
Applications: WB
NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00003281-M02
Species: Hu
Applications: WB, ELISA
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-80388
Species: Hu
Applications: WB

Publications for HSFY1 Antibody (NBP1-80388) (0)

There are no publications for HSFY1 Antibody (NBP1-80388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSFY1 Antibody (NBP1-80388) (0)

There are no reviews for HSFY1 Antibody (NBP1-80388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSFY1 Antibody (NBP1-80388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HSFY1 Antibody (NBP1-80388)

Discover related pathways, diseases and genes to HSFY1 Antibody (NBP1-80388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSFY1 Antibody (NBP1-80388)

Discover more about diseases related to HSFY1 Antibody (NBP1-80388).
 

Pathways for HSFY1 Antibody (NBP1-80388)

View related products by pathway.

Blogs on HSFY1

There are no specific blogs for HSFY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSFY1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSFY1
Uniprot