Recombinant Human HSD17B12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HSD17B12 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 98 of Human HSD17B12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEISNYT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HSD17B12
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HSD17B12 Protein

  • 17-beta-HSD 12
  • 17-beta-hydroxysteroid dehydrogenase 12
  • EC 1.1.1.62,3-ketoacyl-CoA reductase
  • EC 1.3.1.-
  • hydroxysteroid (17-beta) dehydrogenase 12,17beta-HSD type 12
  • KARestradiol 17-beta-dehydrogenase 12
  • SDR12C1
  • short chain dehydrogenase/reductase family 12C, member 1
  • steroid dehydrogenase homolog

Background

The enzyme 17-beta hydroxysteroid dehydrogenase-12 (HSD17B12) uses NADPH to reduce 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during the second step of fatty acid elongation.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76852
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-76853
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
MAB7178
Species: Hu
Applications: WB, Simple Western
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
AF4337
Species: Hu
Applications: WB, IHC, ICC
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NLS921
Species: Hu, Bv
Applications: WB, IHC-P, ICC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HSD17B12 Recombinant Protein (H00051144-P01) (0)

There are no publications for HSD17B12 Recombinant Protein (H00051144-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B12 Recombinant Protein (H00051144-P01) (0)

There are no reviews for HSD17B12 Recombinant Protein (H00051144-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD17B12 Recombinant Protein (H00051144-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSD17B12 Products

Bioinformatics Tool for HSD17B12 Recombinant Protein (H00051144-P01)

Discover related pathways, diseases and genes to HSD17B12 Recombinant Protein (H00051144-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B12 Recombinant Protein (H00051144-P01)

Discover more about diseases related to HSD17B12 Recombinant Protein (H00051144-P01).
 

Pathways for HSD17B12 Recombinant Protein (H00051144-P01)

View related products by pathway.

Blogs on HSD17B12

There are no specific blogs for HSD17B12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HSD17B12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B12