HS3ST2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

HS3ST2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HS3ST2.
  
  

  Source: E. coli

  Amino Acid Sequence: APRCLRGPSAGGQKLLQKSRPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGRG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HS3ST2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89374.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HS3ST2 Recombinant Protein Antigen

• EC 2.8.2
• EC 2.8.2.29,3-OST-2
• h3-OST-2
• heparan sulfate (glucosamine) 3-O-sulfotransferase 2,30ST2,3OST2heparan sulfate glucosamine 3-O-sulfotransferase 2
• Heparan sulfate 3-O-sulfotransferase 2
• Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2
• heparin-glucosamine 3-O-sulfotransferase

Background

HS3ST2 codes for a protein with a length of 367 amino acids and a weight of approximately 41.5 kDa, that is a sulfotransferase that utilizes PAPS and works to transfer a sulfo group to a glucosamine on heparan sulfate, without causing the heparan sulfate to being its anticoagulant form and is highly expressed in the brain with a lesser expression in the heart, lung and skeletal muscle. Current studies are being done on several diseases and disorders related to this gene including herpes simplex, chondrosarcoma, pancreatic cancer, colorectal cancer, pancreatitis, schizophrenia, and neuronitis. HS3ST2 has also been shown to have interactions with GLCE, GPC1, GPC2, GPC4, and GPC5 in pathways such as the heparan sulfate biosynthesis, metapathway biotransformation, Maroteaux-Lamy syndrome, metabolism, and Hunter syndrome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HS3ST2