Recombinant Human HS3ST2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HS3ST2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 268-367 of Human HS3ST2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QIHFVSGERLITDPAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE

Protein/Peptide Type
Partial Recombinant Protein
Gene
HS3ST2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HS3ST2 Protein

  • EC 2.8.2
  • EC 2.8.2.29,3-OST-2
  • h3-OST-2
  • heparan sulfate (glucosamine) 3-O-sulfotransferase 2,30ST2,3OST2heparan sulfate glucosamine 3-O-sulfotransferase 2
  • Heparan sulfate 3-O-sulfotransferase 2
  • Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2
  • heparin-glucosamine 3-O-sulfotransferase

Background

HS3ST2 - heparan sulfate (glucosamine) 3-O-sulfotransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5968
Species: Hu
Applications: WB, IP
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
AF6085
Species: Hu, Mu
Applications: WB, IHC, Neut
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49661
Species: Hu
Applications: WB, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-92162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00055743-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00009956-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HS3ST2 Partial Recombinant Protein (H00009956-Q01) (0)

There are no publications for HS3ST2 Partial Recombinant Protein (H00009956-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HS3ST2 Partial Recombinant Protein (H00009956-Q01) (0)

There are no reviews for HS3ST2 Partial Recombinant Protein (H00009956-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HS3ST2 Partial Recombinant Protein (H00009956-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HS3ST2 Products

Bioinformatics Tool for HS3ST2 Partial Recombinant Protein (H00009956-Q01)

Discover related pathways, diseases and genes to HS3ST2 Partial Recombinant Protein (H00009956-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HS3ST2 Partial Recombinant Protein (H00009956-Q01)

Discover more about diseases related to HS3ST2 Partial Recombinant Protein (H00009956-Q01).
 

Pathways for HS3ST2 Partial Recombinant Protein (H00009956-Q01)

View related products by pathway.

PTMs for HS3ST2 Partial Recombinant Protein (H00009956-Q01)

Learn more about PTMs related to HS3ST2 Partial Recombinant Protein (H00009956-Q01).

Blogs on HS3ST2

There are no specific blogs for HS3ST2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
HS3ST2 Antibody
NBP1-89374

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HS3ST2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HS3ST2