Recombinant Human HS1BP3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HS1BP3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-213 of Human HS1BP3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRLVSCC

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HS1BP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
49.17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HS1BP3 Protein

  • FLJ14249ETM2
  • HCLS1 binding protein 3
  • HCLS1-binding protein 3
  • HS1-binding protein 3
  • HS1-BP3
  • HSP1BP-3

Background

HS1BP3( AAH27947, 1 a.a. - 214 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5789
Species: Hu, Mu, Rt
Applications: WB
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
AF3086
Species: Hu
Applications: WB, IHC
MAB36791
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-67833
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-527
Species: Hu, Mu
Applications: WB
NBP2-13732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
H00064342-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for HS1BP3 Recombinant Protein (H00064342-P01) (0)

There are no publications for HS1BP3 Recombinant Protein (H00064342-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HS1BP3 Recombinant Protein (H00064342-P01) (0)

There are no reviews for HS1BP3 Recombinant Protein (H00064342-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HS1BP3 Recombinant Protein (H00064342-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HS1BP3 Recombinant Protein (H00064342-P01)

Discover related pathways, diseases and genes to HS1BP3 Recombinant Protein (H00064342-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HS1BP3 Recombinant Protein (H00064342-P01)

Discover more about diseases related to HS1BP3 Recombinant Protein (H00064342-P01).
 

Pathways for HS1BP3 Recombinant Protein (H00064342-P01)

View related products by pathway.

PTMs for HS1BP3 Recombinant Protein (H00064342-P01)

Learn more about PTMs related to HS1BP3 Recombinant Protein (H00064342-P01).
 

Research Areas for HS1BP3 Recombinant Protein (H00064342-P01)

Find related products by research area.

Blogs on HS1BP3

There are no specific blogs for HS1BP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HS1BP3 Antibody
NBP1-31055
c-Fos Antibody
NB110-75039

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HS1BP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HS1BP3