HPSC152 Antibody (3E5)

Images

 
Western Blot: HPSC152 Antibody (3E5) [H00051504-M09] - Analysis of HSPC152 expression in transfected 293T cell line by HSPC152 monoclonal antibody (M09), clone 3E5. Lane 1: HSPC152 transfected lysatE (14.2 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HPSC152 Antibody (3E5) Summary

Immunogen
HSPC152 (AAH17172, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Specificity
HSPC152 (3E5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRMT112
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 25851604)
Publications
Read Publication using
H00051504-M09 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HPSC152 Antibody (3E5)

  • HSPC152
  • HSPC170
  • TRM112
  • TRM112-like protein
  • TRMT11-2
  • tRNA methyltransferase 11-2 homolog (S. cerevisiae)
  • tRNA methyltransferase 112 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00060487-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-86906
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
NBP1-31113
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84010
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5059
Species: Hu
Applications: IHC, WB
H00221527-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-13957
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03312
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF3798
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-71419
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
H00023471-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MAB943
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP1-81238
Species: Hu
Applications: IHC, IHC-P, WB
H00051504-M09
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HPSC152 Antibody (H00051504-M09)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HPSC152 Antibody (H00051504-M09) (0)

There are no reviews for HPSC152 Antibody (H00051504-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HPSC152 Antibody (H00051504-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPSC152 Products

Bioinformatics Tool for HPSC152 Antibody (H00051504-M09)

Discover related pathways, diseases and genes to HPSC152 Antibody (H00051504-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPSC152 Antibody (H00051504-M09)

Discover more about diseases related to HPSC152 Antibody (H00051504-M09).
 

Pathways for HPSC152 Antibody (H00051504-M09)

View related products by pathway.

PTMs for HPSC152 Antibody (H00051504-M09)

Learn more about PTMs related to HPSC152 Antibody (H00051504-M09).
 

Research Areas for HPSC152 Antibody (H00051504-M09)

Find related products by research area.

Blogs on HPSC152

There are no specific blogs for HPSC152, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPSC152 Antibody (3E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT112
Entrez
Uniprot