HPCL Antibody - BSA Free

Immunohistochemistry: HACL1 Antibody [NBP2-37877] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HPCL Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPISMAETSAVCTAASVIRNAKQPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HACL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HPCL Protein (NBP2-37877PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HPCL Antibody - BSA Free

• 1600020H07Rik
• 2,2-HPCL
• 2-hydroxyacyl-CoA lyase 1
• 2-hydroxyphytanoyl-CoA lyase2-hydroxyphytanol-CoA lyase
• EC 4.1
• HPCL
• PHYH2FLJ55041
• Phytanoyl-CoA 2-hydroxylase 2
• phytanoyl-CoA hydroxylase 2

Background

HPCL catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HACL1
• Uniprot:
  • Q9UJ83(Human)