HPCL Antibody

Images

 
Western Blot: HPCL Antibody [NBP1-89384] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HPCL Antibody [NBP1-89384] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: HPCL Antibody [NBP1-89384] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPCL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFDTDTWKEMLKFQDATAVVPPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HACL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HPCL Protein (NBP1-89384PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPCL Antibody

  • 1600020H07Rik
  • 2,2-HPCL
  • 2-hydroxyacyl-CoA lyase 1
  • 2-hydroxyphytanoyl-CoA lyase2-hydroxyphytanol-CoA lyase
  • EC 4.1
  • HPCL
  • PHYH2FLJ55041
  • Phytanoyl-CoA 2-hydroxylase 2
  • phytanoyl-CoA hydroxylase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6846
Species: Hu
Applications: IHC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86944
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6108
Species: Hu
Applications: IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82613
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-01017
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89384
Species: Hu, Mu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for HPCL Antibody (NBP1-89384) (0)

There are no publications for HPCL Antibody (NBP1-89384).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPCL Antibody (NBP1-89384) (0)

There are no reviews for HPCL Antibody (NBP1-89384). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HPCL Antibody (NBP1-89384) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPCL Products

Bioinformatics Tool for HPCL Antibody (NBP1-89384)

Discover related pathways, diseases and genes to HPCL Antibody (NBP1-89384). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPCL Antibody (NBP1-89384)

Discover more about diseases related to HPCL Antibody (NBP1-89384).
 

Pathways for HPCL Antibody (NBP1-89384)

View related products by pathway.

PTMs for HPCL Antibody (NBP1-89384)

Learn more about PTMs related to HPCL Antibody (NBP1-89384).

Blogs on HPCL

There are no specific blogs for HPCL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPCL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HACL1