HOXC8 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:FPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGR |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HOXC8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HOXC8 Antibody
Background
The HOXC8 gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcriptionfactors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similarhomeobox gene clusters,
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Publications for HOXC8 Antibody (NBP1-81719) (0)
There are no publications for HOXC8 Antibody (NBP1-81719).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HOXC8 Antibody (NBP1-81719) (0)
There are no reviews for HOXC8 Antibody (NBP1-81719).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HOXC8 Antibody (NBP1-81719) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HOXC8 Products
Blogs on HOXC8