HOXC5 Antibody (1E10)

Images

 
Sandwich ELISA: HOXC5 Antibody (1E10) [H00003222-M01] - Detection limit for recombinant GST tagged HOXC5 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, S-ELISA
Clone
1E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXC5 Antibody (1E10) Summary

Immunogen
HOXC5 (NP_061826.1, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR
Specificity
HOXC5 - homeobox C5 (1E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXC5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.
Publications
Read Publications using
H00003222-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC5 Antibody (1E10)

  • homeo box C5
  • homeobox C5
  • Homeobox protein CP11
  • Homeobox protein Hox-3D
  • homeobox protein Hox-C5
  • HOX3
  • HOX3DCP11

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56195
Species: Hu
Applications: WB, ICC/IF
NBP2-46001
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-23804
Species: Hu, Mu, Rt, Bv, Ca, Pm, Sh
Applications: PEP-ELISA
NBP2-85076
Species: Hu
Applications: WB
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-45744
Species: Hu, Mu, Rt
Applications: WB, IHC
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14098
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00003231-M01
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42520
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00003204-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP3-04717
Species: Hu, Mu, Rt
Applications: WB
NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-600
Species: Hu, Mu, Ca
Applications: WB, ChIP, ELISA, Flow, IB, IHC, IHC-P, Flow-IC, KD

Publications for HOXC5 Antibody (H00003222-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HOXC5 Antibody (H00003222-M01) (0)

There are no reviews for HOXC5 Antibody (H00003222-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXC5 Antibody (H00003222-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXC5 Antibody (1E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXC5
Entrez
Uniprot