HOXC5 Antibody (1E10)

Sandwich ELISA: HOXC5 Antibody (1E10) [H00003222-M01] - Detection limit for recombinant GST tagged HOXC5 is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

HOXC5 Antibody (1E10) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HOXC5 (NP_061826.1, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR
• Specificity: HOXC5 - homeobox C5 (1E10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HOXC5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXC5 Antibody (1E10)

• homeo box C5
• homeobox C5
• Homeobox protein CP11
• Homeobox protein Hox-3D
• homeobox protein Hox-C5
• HOX3
• HOX3DCP11

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXC5 Antibody (H00003222-M01)(2)

Publications using H00003222-M01

• Hirata A, Katayama K, Tsuji T et al. Homeobox family Hoxc localization during murine palate formation. Congenit Anom (Kyoto) 2015-12-31 [PMID: 26718736]
• Moon SM, Ahn MY, Kwon SM et al. Homeobox C5 expression is associated with the progression of 4-nitroquinoline 1-oxide-induced rat tongue carcinogenesis J Oral Pathol Med 2012-07-01 [PMID: 22385119] (WB, Human)

Bioinformatics

• Gene Symbol: HOXC5
• Entrez:
  • 3222(Human)
• Uniprot:
  • NP_061826(Human)