Novus Biologicals products are now on bio-techne.com

Recombinant Human HOXB9 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human HOXB9 Protein [H00003219-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human HOXB9 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 250 of Human HOXB9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
HOXB9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
54.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXB9 GST (N-Term) Protein

  • homeo box 2E
  • homeo box B9
  • homeobox B9
  • Homeobox protein Hox-2.5
  • Homeobox protein Hox-2E
  • homeobox protein Hox-B9
  • HOX-2.5
  • HOX2EHOX2

Background

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6318
Species: Hu
Applications: ICC
H00003216-M01-100ug
Species: Hu
Applications: ELISA, WB
NBP3-15720
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
NBP2-87596
Species: Hu
Applications: IHC, IHC-P, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-85076
Species: Hu
Applications: WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP2-46587
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-83058
Species: Hu
Applications: WB
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
1129-ER
Species: Hu
Applications: BA
H00003223-M04
Species: Hu
Applications: ELISA, WB
H00003231-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
H00003219-P01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for HOXB9 Recombinant Protein (H00003219-P01) (0)

There are no publications for HOXB9 Recombinant Protein (H00003219-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB9 Recombinant Protein (H00003219-P01) (0)

There are no reviews for HOXB9 Recombinant Protein (H00003219-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB9 Recombinant Protein (H00003219-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXB9 Products

Blogs on HOXB9

There are no specific blogs for HOXB9, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXB9 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB9