Recombinant Human HOXB9 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HOXB9 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 250 of Human HOXB9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HOXB9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
54.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXB9 Protein

  • homeo box 2E
  • homeo box B9
  • homeobox B9
  • Homeobox protein Hox-2.5
  • Homeobox protein Hox-2E
  • homeobox protein Hox-B9
  • HOX-2.5
  • HOX2EHOX2

Background

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6318
Species: Hu
Applications: ICC
H00003216-M01-100ug
Species: Hu
Applications: WB, ELISA
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56557
Species: Hu
Applications: ICC/IF
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP2-56537
Species: Hu
Applications: ICC/IF
NBL1-11664
Species: Hu
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
NBP2-54948
Species: Hu
Applications: ICC/IF
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
H00003219-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for HOXB9 Recombinant Protein (H00003219-P01) (0)

There are no publications for HOXB9 Recombinant Protein (H00003219-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB9 Recombinant Protein (H00003219-P01) (0)

There are no reviews for HOXB9 Recombinant Protein (H00003219-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB9 Recombinant Protein (H00003219-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXB9 Products

Bioinformatics Tool for HOXB9 Recombinant Protein (H00003219-P01)

Discover related pathways, diseases and genes to HOXB9 Recombinant Protein (H00003219-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB9 Recombinant Protein (H00003219-P01)

Discover more about diseases related to HOXB9 Recombinant Protein (H00003219-P01).
 

Pathways for HOXB9 Recombinant Protein (H00003219-P01)

View related products by pathway.

PTMs for HOXB9 Recombinant Protein (H00003219-P01)

Learn more about PTMs related to HOXB9 Recombinant Protein (H00003219-P01).

Blogs on HOXB9

There are no specific blogs for HOXB9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOXB9 Antibody
H00003219-D03P
EGR2 Antibody
NB110-59723

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXB9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB9