Recombinant Human HOXB6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOXB6 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 57 of Human HOXB6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS

Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXB6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXB6 Protein

  • homeo box 2B
  • homeo box B6
  • homeobox B6
  • Homeobox protein Hox-2.2
  • Homeobox protein Hox-2B
  • homeobox protein Hox-B6
  • Homeobox protein Hu-2
  • HOX2
  • Hox-2.2
  • HOX2BHU-2

Background

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-56537
Species: Hu
Applications: ICC/IF
H00003219-D03P
Species: Hu, Mu
Applications: WB
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBL1-11664
Species: Hu
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP2-57662
Species: Hu
Applications: ICC/IF
NBP1-80228
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19853
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
H00003216-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for HOXB6 Partial Recombinant Protein (H00003216-Q01) (0)

There are no publications for HOXB6 Partial Recombinant Protein (H00003216-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB6 Partial Recombinant Protein (H00003216-Q01) (0)

There are no reviews for HOXB6 Partial Recombinant Protein (H00003216-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB6 Partial Recombinant Protein (H00003216-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXB6 Products

Bioinformatics Tool for HOXB6 Partial Recombinant Protein (H00003216-Q01)

Discover related pathways, diseases and genes to HOXB6 Partial Recombinant Protein (H00003216-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB6 Partial Recombinant Protein (H00003216-Q01)

Discover more about diseases related to HOXB6 Partial Recombinant Protein (H00003216-Q01).
 

Pathways for HOXB6 Partial Recombinant Protein (H00003216-Q01)

View related products by pathway.

PTMs for HOXB6 Partial Recombinant Protein (H00003216-Q01)

Learn more about PTMs related to HOXB6 Partial Recombinant Protein (H00003216-Q01).

Blogs on HOXB6

There are no specific blogs for HOXB6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOXA9 Antibody
NBP2-24633
HOXB4 Antibody
NBP2-24561

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXB6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB6