Recombinant Human HOXA6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOXA6 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 233 of Human HOXA6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAKAGE

Protein/Peptide Type
Recombinant Protein
Gene
HOXA6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXA6 Protein

  • homeo box A6
  • homeobox A6
  • Homeobox protein Hox-1B
  • homeobox protein HOXA6
  • homeobox protein Hox-A6
  • HOX1
  • HOX1.2
  • HOX1Bhomeo box 1B

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11664
Species: Hu
NBP2-57662
Species: Hu
Applications: ICC/IF
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45744
Species: Hu
Applications: WB, IHC
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBL1-11673
Species: Hu
NBP2-56537
Species: Hu
Applications: ICC/IF

Publications for HOXA6 Recombinant Protein (H00003203-P01) (0)

There are no publications for HOXA6 Recombinant Protein (H00003203-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA6 Recombinant Protein (H00003203-P01) (0)

There are no reviews for HOXA6 Recombinant Protein (H00003203-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA6 Recombinant Protein (H00003203-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXA6 Products

Bioinformatics Tool for HOXA6 Recombinant Protein (H00003203-P01)

Discover related pathways, diseases and genes to HOXA6 Recombinant Protein (H00003203-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA6 Recombinant Protein (H00003203-P01)

Discover more about diseases related to HOXA6 Recombinant Protein (H00003203-P01).
 

Pathways for HOXA6 Recombinant Protein (H00003203-P01)

View related products by pathway.

PTMs for HOXA6 Recombinant Protein (H00003203-P01)

Learn more about PTMs related to HOXA6 Recombinant Protein (H00003203-P01).

Blogs on HOXA6

There are no specific blogs for HOXA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZEB2 Antibody
NBP1-82991
HOXA6 Antibody
NBP1-83236

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXA6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA6