Recombinant Human HOXA1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOXA1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 335 of Human HOXA1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH

Protein/Peptide Type
Recombinant Protein
Gene
HOXA1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXA1 Protein

  • BSAS
  • homeo box A1
  • homeobox A1
  • Homeobox protein Hox-1F
  • homeobox protein Hox-A1
  • Hox 1.6-like protein
  • HOX A1 homeodomain protein
  • HOX1
  • HOX1F
  • HOX1Fhomeobox 1F
  • HOXA1
  • lab-like protein
  • MGC45232

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. HOXA1( AAH32547, 1 a.a. - 336 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6318
Species: Hu
Applications: ICC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBL1-11664
Species: Hu
NBP2-58865
Species: Hu
Applications: ICC/IF
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HOXA1 Recombinant Protein (H00003198-P01) (0)

There are no publications for HOXA1 Recombinant Protein (H00003198-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA1 Recombinant Protein (H00003198-P01) (0)

There are no reviews for HOXA1 Recombinant Protein (H00003198-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA1 Recombinant Protein (H00003198-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXA1 Products

Bioinformatics Tool for HOXA1 Recombinant Protein (H00003198-P01)

Discover related pathways, diseases and genes to HOXA1 Recombinant Protein (H00003198-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA1 Recombinant Protein (H00003198-P01)

Discover more about diseases related to HOXA1 Recombinant Protein (H00003198-P01).
 

Pathways for HOXA1 Recombinant Protein (H00003198-P01)

View related products by pathway.

PTMs for HOXA1 Recombinant Protein (H00003198-P01)

Learn more about PTMs related to HOXA1 Recombinant Protein (H00003198-P01).

Blogs on HOXA1

There are no specific blogs for HOXA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
EGR2 Antibody
NB110-59723

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA1
Entrez