Recombinant Human HOXA1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HOXA1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 11-119 of Human HOXA1

Source: Wheat Germ

Amino Acid Sequence: EYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXA1 Protein

  • BSAS
  • homeo box A1
  • homeobox A1
  • Homeobox protein Hox-1F
  • homeobox protein Hox-A1
  • Hox 1.6-like protein
  • HOX A1 homeodomain protein
  • HOX1
  • HOX1F
  • HOX1Fhomeobox 1F
  • HOXA1
  • lab-like protein
  • MGC45232

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6318
Species: Hu
Applications: ICC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBL1-11664
Species: Hu
NBL1-11666
Species: Hu
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HOXA1 Partial Recombinant Protein (H00003198-Q01) (0)

There are no publications for HOXA1 Partial Recombinant Protein (H00003198-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA1 Partial Recombinant Protein (H00003198-Q01) (0)

There are no reviews for HOXA1 Partial Recombinant Protein (H00003198-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA1 Partial Recombinant Protein (H00003198-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXA1 Products

Bioinformatics Tool for HOXA1 Partial Recombinant Protein (H00003198-Q01)

Discover related pathways, diseases and genes to HOXA1 Partial Recombinant Protein (H00003198-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA1 Partial Recombinant Protein (H00003198-Q01)

Discover more about diseases related to HOXA1 Partial Recombinant Protein (H00003198-Q01).
 

Pathways for HOXA1 Partial Recombinant Protein (H00003198-Q01)

View related products by pathway.

PTMs for HOXA1 Partial Recombinant Protein (H00003198-Q01)

Learn more about PTMs related to HOXA1 Partial Recombinant Protein (H00003198-Q01).

Blogs on HOXA1

There are no specific blogs for HOXA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
EGR2 Antibody
NB110-59723

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA1
Entrez