HN1L Recombinant Protein Antigen

Images

 
There are currently no images for HN1L Protein (NBP1-88445PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HN1L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HN1L.

Source: E.coli

Amino Acid Sequence: FGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HN1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88445.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HN1L Recombinant Protein Antigen

  • C16orf34
  • chromosome 16 open reading frame 34
  • CRAMP_1 like
  • FLJ13092
  • hematological and neurological expressed 1-like protein
  • hematological and neurological expressed 1-like
  • HN1 like
  • HN1-like protein
  • KIAA1426
  • L11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
NBP3-05567
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88445PEP
Species: Hu
Applications: AC

Publications for HN1L Protein (NBP1-88445PEP) (0)

There are no publications for HN1L Protein (NBP1-88445PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HN1L Protein (NBP1-88445PEP) (0)

There are no reviews for HN1L Protein (NBP1-88445PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HN1L Protein (NBP1-88445PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional HN1L Products

Bioinformatics Tool for HN1L Protein (NBP1-88445PEP)

Discover related pathways, diseases and genes to HN1L Protein (NBP1-88445PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for HN1L Protein (NBP1-88445PEP)

View related products by pathway.

Blogs on HN1L

There are no specific blogs for HN1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HN1L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HN1L