HMGB2 Antibody

Images

 
Western Blot: HMGB2 Antibody [H00003148-D01P] - Analysis of HMGB2 expression in transfected 293T cell line by HMGB2 polyclonal antibody.Lane 1: HMGB2 transfected lysate(24.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HMGB2 Antibody Summary

Immunogen
HMGB2 (NP_002120.1, 1 a.a. - 209 a.a.) full-length human protein. MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Specificity
HMGB2 - high-mobility group box 2,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGB2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HMGB2 Antibody

  • High mobility group protein 2
  • high mobility group protein B2
  • high-mobility group box 2
  • HMG-2
  • HMG2high-mobility group (nonhistone chromosomal) protein 2

Background

This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF5507
Species: Hu, Mu
Applications: WB
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74190
Species: Mu
Applications: WB, ChIP
NBP1-30888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-84754
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-34098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41159
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-14842
Species: Hu, Po, Bv, Ca, Pm, Rb
Applications: WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HMGB2 Antibody (H00003148-D01P) (0)

There are no publications for HMGB2 Antibody (H00003148-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMGB2 Antibody (H00003148-D01P) (0)

There are no reviews for HMGB2 Antibody (H00003148-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGB2 Antibody (H00003148-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGB2 Products

Bioinformatics Tool for HMGB2 Antibody (H00003148-D01P)

Discover related pathways, diseases and genes to HMGB2 Antibody (H00003148-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGB2 Antibody (H00003148-D01P)

Discover more about diseases related to HMGB2 Antibody (H00003148-D01P).
 

Pathways for HMGB2 Antibody (H00003148-D01P)

View related products by pathway.

PTMs for HMGB2 Antibody (H00003148-D01P)

Learn more about PTMs related to HMGB2 Antibody (H00003148-D01P).
 

Research Areas for HMGB2 Antibody (H00003148-D01P)

Find related products by research area.

Blogs on HMGB2

There are no specific blogs for HMGB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMGB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGB2
Entrez
Uniprot