Novus Biologicals products are now on bio-techne.com

HLA DQB2 Antibody (4C3)

Images

 
Western Blot: HLA DQB2 Antibody (4C3) [H00003120-M01] - Analysis of HLA-DQB2 expression in transfected 293T cell line by HLA-DQB2 monoclonal antibody (M01), clone 4C3.Lane 1: HLA-DQB2 transfected lysate (Predicted MW: ...read more
Sandwich ELISA: HLA DQB2 Antibody (4C3) [H00003120-M01] - Detection limit for recombinant GST tagged HLA-DQB2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HLA DQB2 Antibody (4C3) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
HLA-DQB2 (AAH31995, 1 a.a. ~ 231 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVQWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPSLQSPITVEWRPRGPPPAGLLH
Specificity
HLA-DQB2 - major histocompatibility complex, class II, DQ beta 2 (4C3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HLA-DQB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DQB2 Antibody (4C3)

  • class II, DQ beta 1
  • DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB))
  • HLA-DQB1
  • major histocompatibility complex, class II, DQ beta 2

Background

HLA-DQB2( AAH31995, 1 a.a. - 232 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
NBP2-14093
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-89688
Species: Hu
Applications: IHC, IHC-P, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
7268-CT
Species: Hu
Applications: BA
AF347
Species: Hu
Applications: IHC, Neut, WB
AF2247
Species: Hu
Applications: IHC, WB
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
MAB9080
Species: Hu
Applications: WB
H00003120-M01
Species: Hu
Applications: WB, ELISA

Publications for HLA DQB2 Antibody (H00003120-M01) (0)

There are no publications for HLA DQB2 Antibody (H00003120-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DQB2 Antibody (H00003120-M01) (0)

There are no reviews for HLA DQB2 Antibody (H00003120-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DQB2 Antibody (H00003120-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DQB2 Products

Research Areas for HLA DQB2 Antibody (H00003120-M01)

Find related products by research area.

Blogs on HLA DQB2

There are no specific blogs for HLA DQB2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DQB2 Antibody (4C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DQB2
Entrez
Uniprot