HLA DQB1 Partial Protein

Images

 
SDS-Page: HLA DQB1 Partial Protein [H00003119-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

HLA DQB1 Partial Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 129-217 of Human HLA DQB1

Source: Wheat Germ

Amino Acid Sequence: PTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPII

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Protein
Gene
HLA-DQB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DQB1 Partial Protein

  • DC-1 alpha chain
  • DC-alpha
  • HLA class II histocompatibility antigen, DQ alpha 1 chain-like
  • HLA-DCA
  • MHC class II DQA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-2705
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF347
Species: Hu
Applications: WB, IHC, Neut
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003119-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for HLA DQB1 Partial Recombinant Protein (H00003119-Q01) (0)

There are no publications for HLA DQB1 Partial Recombinant Protein (H00003119-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DQB1 Partial Recombinant Protein (H00003119-Q01) (0)

There are no reviews for HLA DQB1 Partial Recombinant Protein (H00003119-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DQB1 Partial Recombinant Protein (H00003119-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HLA DQB1 Products

Bioinformatics Tool for HLA DQB1 Partial Recombinant Protein (H00003119-Q01)

Discover related pathways, diseases and genes to HLA DQB1 Partial Recombinant Protein (H00003119-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DQB1 Partial Recombinant Protein (H00003119-Q01)

Discover more about diseases related to HLA DQB1 Partial Recombinant Protein (H00003119-Q01).
 

Pathways for HLA DQB1 Partial Recombinant Protein (H00003119-Q01)

View related products by pathway.

PTMs for HLA DQB1 Partial Recombinant Protein (H00003119-Q01)

Learn more about PTMs related to HLA DQB1 Partial Recombinant Protein (H00003119-Q01).
 

Research Areas for HLA DQB1 Partial Recombinant Protein (H00003119-Q01)

Find related products by research area.

Blogs on HLA DQB1

There are no specific blogs for HLA DQB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DQB1 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DQB1