Histone H2AY/macroH2A.1 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Knockout (KO) Validated Rabbit Histone H2AY/macroH2A.1 Antibody - Azide and BSA Free (NBP3-03379) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 123-372 of human Histone H2AY/macroH2A.1 (NP_613258.2). KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDAN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MACROH2A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:100
- Knockout Validated
- Western Blot 1:500-1:2000
|
| Theoretical MW |
39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Histone H2AY/macroH2A.1 Antibody - Azide and BSA Free
Background
macroH2A.1 (H2AFY) is 372 amino acids long, weighs approximately 40 kDa, and is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. macroH2a.1 has two shorter isoforms meeasuring 371 and 369 amino acids long, both weighing approximately 39 kDa. Current studies are being done on several diseases and disorders including medulloblastoma, lupus erythematosus, Huntington's disease, immunodeficiency, melanoma, and malaria. macroH2A.1 has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the chromatin regulation/ acetylation, systemic lupus erythematosus, and ATF-2 transcription factor pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, KO
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Histone H2AY/macroH2A.1 Antibody (NBP3-03379) (0)
There are no publications for Histone H2AY/macroH2A.1 Antibody (NBP3-03379).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Histone H2AY/macroH2A.1 Antibody (NBP3-03379) (0)
There are no reviews for Histone H2AY/macroH2A.1 Antibody (NBP3-03379).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Histone H2AY/macroH2A.1 Antibody (NBP3-03379) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Histone H2AY/macroH2A.1 Products
Blogs on Histone H2AY/macroH2A.1