Histone H2AY/macroH2A.1 Antibody - BSA Free

Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP2-56819] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: Histone H2AY/macroH2A.1 Antibody [NBP2-56819] - Staining of human cell line A-431 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Histone H2AY/macroH2A.1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK
• Predicted Species: Mouse (96%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MACROH2A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Histone H2AY/macroH2A.1 Recombinant Protein Antigen (NBP2-56819PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Histone H2AY/macroH2A.1 Antibody - BSA Free

• core histone macro-H2A.1
• H2A histone family, member Y
• H2A.y
• H2A/y
• H2AF12M
• H2AFJ
• H2AFY
• Histone H2A.y
• Histone H2AY
• Histone MacroH2A1
• histone macroH2A1.1
• histone macroH2A1.2
• MACROH2A1
• MACROH2A1.1
• macroH2A1.2
• Medulloblastoma Antigen MU-MB-50.205
• mH2A1

Background

macroH2A.1 (H2AFY) is 372 amino acids long, weighs approximately 40 kDa, and is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. macroH2a.1 has two shorter isoforms meeasuring 371 and 369 amino acids long, both weighing approximately 39 kDa. Current studies are being done on several diseases and disorders including medulloblastoma, lupus erythematosus, Huntington's disease, immunodeficiency, melanoma, and malaria. macroH2A.1 has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the chromatin regulation/ acetylation, systemic lupus erythematosus, and ATF-2 transcription factor pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MACROH2A1