Histone H1.1 Antibody

Western Blot: Histone H1.1 Antibody [H00003024-B01P] - Analysis of HIST1H1A expression in transfected 293T cell line by HIST1H1A polyclonal antibody. Lane 1: HIST1H1A transfected lysate(23.65 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Histone H1.1 Antibody [H00003024-B01P] - Analysis of purified antibody to HIST1H1A on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

Histone H1.1 Antibody Summary

• Immunogen: HIST1H1A (NP_005316.1, 1 a.a. - 215 a.a.) full-length human protein. MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK
• Marker: Nuclear Marker
• Specificity: HIST1H1A - histone cluster 1, H1a,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: H1-1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histone H1.1 Antibody

• H1 histone family, member 1
• H1.1
• H1A
• H1F1HIST1
• histone 1, H1a
• histone cluster 1, H1a
• histone H1.1
• MGC126642
• MGC138345

Background

Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H1-1
• Entrez:
  • 3024(Human)
• Uniprot:
  • NP_005316.1(Human)