Recombinant Human Hippocalcin like 4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Hippocalcin like 4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-191 of Human HPCAL4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HPCAL4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hippocalcin like 4 Protein

  • hippocalcin like 4
  • hippocalcin-like protein 4
  • HLP4DKFZp761G122

Background

HPCAL4( AAH30827, 1 a.a. - 192 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25166
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
AF873
Species: Hu
Applications: WB
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81223
Species: Hu
Applications: IHC, IHC-P
NBP2-15037
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-82210
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33086
Species: Hu
Applications: WB, ICC/IF
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003208-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
H00055922-M06
Species: Hu
Applications: WB, ELISA
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14988
Species: Hu, Mu
Applications: WB
H00051440-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Hippocalcin like 4 Recombinant Protein (H00051440-P01) (0)

There are no publications for Hippocalcin like 4 Recombinant Protein (H00051440-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hippocalcin like 4 Recombinant Protein (H00051440-P01) (0)

There are no reviews for Hippocalcin like 4 Recombinant Protein (H00051440-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hippocalcin like 4 Recombinant Protein (H00051440-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hippocalcin like 4 Products

Bioinformatics Tool for Hippocalcin like 4 Recombinant Protein (H00051440-P01)

Discover related pathways, diseases and genes to Hippocalcin like 4 Recombinant Protein (H00051440-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hippocalcin like 4 Recombinant Protein (H00051440-P01)

Discover more about diseases related to Hippocalcin like 4 Recombinant Protein (H00051440-P01).
 

Pathways for Hippocalcin like 4 Recombinant Protein (H00051440-P01)

View related products by pathway.

PTMs for Hippocalcin like 4 Recombinant Protein (H00051440-P01)

Learn more about PTMs related to Hippocalcin like 4 Recombinant Protein (H00051440-P01).
 

Research Areas for Hippocalcin like 4 Recombinant Protein (H00051440-P01)

Find related products by research area.

Blogs on Hippocalcin like 4

There are no specific blogs for Hippocalcin like 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Kif2a Antibody
NB500-180

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hippocalcin like 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HPCAL4