Recombinant Human HIC1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HIC1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 627-705 of Human HIC1

Source: Wheat Germ

Amino Acid Sequence: PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HIC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HIC1 Protein

  • hic-1
  • hypermethylated in cancer 1
  • ZBTB29hypermethylated in cancer 1 protein
  • Zinc finger and BTB domain-containing protein 29
  • ZNF901

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
MAB6798
Species: Hu
Applications: WB, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-82454
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB

Publications for HIC1 Partial Recombinant Protein (H00003090-Q02) (0)

There are no publications for HIC1 Partial Recombinant Protein (H00003090-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIC1 Partial Recombinant Protein (H00003090-Q02) (0)

There are no reviews for HIC1 Partial Recombinant Protein (H00003090-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIC1 Partial Recombinant Protein (H00003090-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HIC1 Partial Recombinant Protein (H00003090-Q02)

Discover related pathways, diseases and genes to HIC1 Partial Recombinant Protein (H00003090-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIC1 Partial Recombinant Protein (H00003090-Q02)

Discover more about diseases related to HIC1 Partial Recombinant Protein (H00003090-Q02).
 

Pathways for HIC1 Partial Recombinant Protein (H00003090-Q02)

View related products by pathway.

PTMs for HIC1 Partial Recombinant Protein (H00003090-Q02)

Learn more about PTMs related to HIC1 Partial Recombinant Protein (H00003090-Q02).
 

Research Areas for HIC1 Partial Recombinant Protein (H00003090-Q02)

Find related products by research area.

Blogs on HIC1

There are no specific blogs for HIC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
HIC1 Antibody (2F9)
H00003090-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HIC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIC1