Hephaestin Antibody


Western Blot: Hephaestin Antibody [NBP1-62496] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Hephaestin Antibody Summary

Synthetic peptides corresponding to HEPH(hephaestin) The peptide sequence was selected from the N terminal of HEPH. Peptide sequence MHAINGFVFGNLPELNMCAQKRVAWHLFGMGNEIDVHTAFFHGQMLTTRG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HEPH and was validated on Western blot.
Theoretical MW
100 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Hephaestin Antibody

  • EC
  • hephaestin
  • KIAA0698CPL


B1AJX8(HEPH) is similar to an iron transport protein found in mouse. The mouse protein is similar to ceruloplasmin, a serum multi-copper ferroxidase, and is thought to be a membrane-bound protein responsible for transport of dietary iron from epithelial cells of the intestinal lumen into the circulatory system. In mouse, defects in this gene can lead to severe microcytic anemia. Three transcript variants encoding different isoforms have been described for this gene. The protein encoded by this gene is similar to an iron transport protein found in mouse. The mouse protein is similar to ceruloplasmin, a serum multi-copper ferroxidase, and is thought to be a membrane-bound protein responsible for transport of dietary iron from epithelial cells of the intestinal lumen into the circulatory system. In mouse, defects in this gene can lead to severe microcytic anemia. Two transcript variants encoding different isoforms have been described for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Bv
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Po, Rb, Bv(-), Ca(-), Eq(-), Sh(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Bv
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Mu
Applications: WB
Species: Hu
Species: Hu
Applications: WB

Publications for Hephaestin Antibody (NBP1-62496) (0)

There are no publications for Hephaestin Antibody (NBP1-62496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hephaestin Antibody (NBP1-62496) (0)

There are no reviews for Hephaestin Antibody (NBP1-62496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hephaestin Antibody (NBP1-62496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Hephaestin Antibody (NBP1-62496)

Discover related pathways, diseases and genes to Hephaestin Antibody (NBP1-62496). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hephaestin Antibody (NBP1-62496)

Discover more about diseases related to Hephaestin Antibody (NBP1-62496).

Pathways for Hephaestin Antibody (NBP1-62496)

View related products by pathway.

PTMs for Hephaestin Antibody (NBP1-62496)

Learn more about PTMs related to Hephaestin Antibody (NBP1-62496).

Blogs on Hephaestin

There are no specific blogs for Hephaestin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Hephaestin Antibody and receive a gift card or discount.


Gene Symbol HEPH