Hepassocin/FGL1 Antibody (2C7)

Images

 
ELISA: Hepassocin/FGL1 Antibody (2C7) [H00002267-M06] - Detection limit for recombinant GST tagged FGL1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hepassocin/FGL1 Antibody (2C7) Summary

Immunogen
FGL1 (AAH07047.1, 19 a.a. - 312 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Specificity
FGL1 - fibrinogen-like 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FGL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hepassocin/FGL1 Antibody (2C7)

  • FGL1
  • fibrinogen-like 1
  • fibrinogen-like protein 1
  • Fibrinogen-like-protein 1
  • FREP1
  • Hepassocin
  • hepatocellular carcinoma-related sequence
  • Hepatocyte-derived fibrinogen-related protein 1
  • HFREP-1
  • HFREP1MGC12455
  • HP-041
  • LFIRE1
  • LFIRE-1
  • Liver fibrinogen-related protein 1

Background

Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31848
Species: Hu
Applications: IHC, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF1239
Species: Mu
Applications: WB, IHC, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF972
Species: Hu
Applications: WB, Simple Western, IHC
AF877
Species: Hu
Applications: WB, IHC, IP
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002267-M06
Species: Hu
Applications: WB, ELISA

Publications for Hepassocin/FGL1 Antibody (H00002267-M06) (0)

There are no publications for Hepassocin/FGL1 Antibody (H00002267-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hepassocin/FGL1 Antibody (H00002267-M06) (0)

There are no reviews for Hepassocin/FGL1 Antibody (H00002267-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hepassocin/FGL1 Antibody (H00002267-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hepassocin/FGL1 Products

Bioinformatics Tool for Hepassocin/FGL1 Antibody (H00002267-M06)

Discover related pathways, diseases and genes to Hepassocin/FGL1 Antibody (H00002267-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hepassocin/FGL1 Antibody (H00002267-M06)

Discover more about diseases related to Hepassocin/FGL1 Antibody (H00002267-M06).
 

Pathways for Hepassocin/FGL1 Antibody (H00002267-M06)

View related products by pathway.

PTMs for Hepassocin/FGL1 Antibody (H00002267-M06)

Learn more about PTMs related to Hepassocin/FGL1 Antibody (H00002267-M06).

Blogs on Hepassocin/FGL1

There are no specific blogs for Hepassocin/FGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hepassocin/FGL1 Antibody (2C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol FGL1
Entrez
OMIM
Uniprot