HE4/WFDC2 Recombinant Protein Antigen

Images

 
There are currently no images for HE4/WFDC2 Recombinant Protein Antigen (NBP2-48762PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HE4/WFDC2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HE4/WFDC2.

Source: E. coli

Amino Acid Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WFDC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48762.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HE4/WFDC2 Recombinant Protein Antigen

  • dJ461P17.6
  • EDDM4
  • Epididymal secretory protein E4
  • epididymis-specific, whey-acidic protein type, four-disulfide core
  • HE4
  • HE4MGC57529
  • Major epididymis-specific protein E4
  • Putative protease inhibitor WAP5
  • WAP domain containing protein HE4-V4
  • WAP four-disulfide core domain 2
  • WAP four-disulfide core domain protein 2
  • WAP5
  • WAP5epididymal protein 4
  • WFDC2

Background

The HE4 gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

5609-MU
Species: Hu
Applications: Bind
NBL1-09824
Species: Hu
Applications: WB
MAB32652
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, KO
DPI00
Species: Hu
Applications: ELISA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
H00009354-M08
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP1-84943
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-84012
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-75896
Species: Pm-Cm, Hu, RM
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vivo, WB
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DY1747
Species: Hu
Applications: ELISA
DMP700
Species: Hu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
DVE00
Species: Hu
Applications: ELISA

Publications for HE4/WFDC2 Recombinant Protein Antigen (NBP2-48762PEP) (0)

There are no publications for HE4/WFDC2 Recombinant Protein Antigen (NBP2-48762PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HE4/WFDC2 Recombinant Protein Antigen (NBP2-48762PEP) (0)

There are no reviews for HE4/WFDC2 Recombinant Protein Antigen (NBP2-48762PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HE4/WFDC2 Recombinant Protein Antigen (NBP2-48762PEP). (Showing 1 - 1 of 1 FAQ).

  1. I would like to build a sandwich ELISA for detection of HE4 levels in human blood. I found there are several HE4 antibodies from your company. Could you please provide me some information among these products, which two antibodies will work well with the HE4 antigen in a sandwich ELISA pair?
    • At this time we have not tested any of our HE4 antibodies for use in a Sandwich ELISA. As such, we cannot say with certainty, which will work together as an effective pair. Often times in our experience, choosing a monoclonal antibody for capture, and a polyclonal antibody for detection will yield great results. If you plan on testing any of our HE4 antibodies for use in a Sandwich ELISA then we would encourage you to apply for our Innovators Reward Program. Under the terms of this program, you will be eligible for a full credit in exchange for your data, in the form of an online review, regardless of positive or negative results. Additional Innovator’s Reward information can be found at the following here

Additional HE4/WFDC2 Products

Research Areas for HE4/WFDC2 Recombinant Protein Antigen (NBP2-48762PEP)

Find related products by research area.

Blogs on HE4/WFDC2

There are no specific blogs for HE4/WFDC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HE4/WFDC2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WFDC2