HDC2/PHC2 Recombinant Protein Antigen

Images

 
There are currently no images for HDC2/PHC2 Protein (NBP1-91979PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HDC2/PHC2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHC2.

Source: E. coli

Amino Acid Sequence: PQLASVSPSVALQPSSEAHAMPLGPVTPALPLQCPTANLHKPGGSQQCHPPTPDTGPQNGHPEGVPHTPQRRFQHTSAVILQLQPASPVPQQCVPDDWKEVAPGEKSVPETRSGPSPHQQAIVTAMP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PHC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91979.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HDC2/PHC2 Recombinant Protein Antigen

  • early development regulator 2 (homolog of polyhomeotic 2)
  • Early development regulatory protein 2
  • EDR2
  • HPH2
  • MGC163502
  • PH2
  • polyhomeotic 2
  • polyhomeotic homolog 2 (Drosophila)
  • polyhomeotic-like 2 (Drosophila)
  • polyhomeotic-like 2
  • polyhomeotic-like protein 2

Background

In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37371
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP1-89200
Species: Hu, Mu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-48615
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84896
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-81555
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
NBP2-37370
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NBP2-03348
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00006045-M01
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NB100-1240
Species: Hu
Applications: PEP-ELISA, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00009261-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, PLA, Simple Western, WB

Publications for HDC2/PHC2 Protein (NBP1-91979PEP) (0)

There are no publications for HDC2/PHC2 Protein (NBP1-91979PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDC2/PHC2 Protein (NBP1-91979PEP) (0)

There are no reviews for HDC2/PHC2 Protein (NBP1-91979PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HDC2/PHC2 Protein (NBP1-91979PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HDC2/PHC2 Products

Research Areas for HDC2/PHC2 Protein (NBP1-91979PEP)

Find related products by research area.

Blogs on HDC2/PHC2

There are no specific blogs for HDC2/PHC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HDC2/PHC2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PHC2